CAZyme Information: MGYG000001441_01527

Basic Information

• Species: Pauljensenia sp000411415
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp000411415
• CAZyme ID: MGYG000001441_01527
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000001441_2|CGC6	49128.4	5.135

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001441	2428388	Isolate	not provided	not provided

• Gene Location: Start: 533344; End: 534783 Strand: -

Full Sequence      

MSHHLSTSLSASAASALHVLGGRLRSFTPSPRAVLGVAALASAGVFGIAGVGVASSHTSV
MLEVNGVSRPVTSWGNTVGDALKAAGVSVGSNDLVQPGPGEAVRDGDTIVVRTSKAYTVN
VDGQTRTLWTTASSADSILADAAPLGSAVSLAADRSSSRDELTPLVSRARNVSVTVDGST
REVAARPGQDARAILEAAGVSVHPLDRVTVSNGPTGELTINVSRVTRGEATETVEIPFSE
TTTTSADLFVGESQVTTAGVNGATTWTVWQEKNGDEVLTSVPITEHSTSQPVTQVRSEGT
KEATPAALVAAGIDPKATLEEKTEADGTTSVRYRAKLGTISTKEEIAAIAADTKNADSAT
AAAAAAAAAAAGAVPTTYSGEDPRSLAKPLVAAQGWGDSEYQCLVLLWNRESQWNPYAEN
ASSGAYGIPQALPGSKMASAGADWRTNPVTQINWGIGYIKGRYGTPCSAWAHSNAVGWY

Enzyme Prediction     

No EC number prediction in MGYG000001441_01527.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	5.73e-33	45	318	25	301	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam07501	G5	1.96e-09	229	301	3	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam03990	DUF348	4.04e-07	60	99	1	40	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.
NF033840	PspC_relate_1	4.36e-04	105	309	211	403	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
pfam03990	DUF348	5.41e-04	118	154	2	41	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT35005.1	1.34e-302	1	479	1	479
QGS11535.1	7.08e-298	1	479	1	479
AKU65287.1	5.53e-281	1	479	1	469
QQC44019.1	5.53e-281	1	479	1	469
QPK82169.1	3.58e-168	61	479	1	412

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R3E0	1.13e-09	48	236	15	206	Resuscitation-promoting factor RpfB OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rpfB PE=3 SV=2
H8EZH5	3.58e-09	50	262	18	232	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfB PE=2 SV=1
P9WG28	3.58e-09	50	262	18	232	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfB PE=3 SV=1
P9WG29	3.58e-09	50	262	18	232	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995142	0.004780	0.000022	0.000023	0.000011	0.000024

TMHMM  Annotations     

start	end
33	55