CAZyme Information: MGYG000001441_01551

Basic Information

• Species: Pauljensenia sp000411415
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp000411415
• CAZyme ID: MGYG000001441_01551
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000001441_2|CGC7	41113.49	8.4161

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001441	2428388	Isolate	not provided	not provided

• Gene Location: Start: 559609; End: 560763 Strand: -

Full Sequence      

MKVLVVPMLARSRMGGPWSRAQRVARAFQDGGHEVTLACGDDGNCADPIASTLEIPVPSP
LGLPEAIARHTFPLASRLGLMGRKPVHSFEEVLWLTGALDERYTRAAVDTLRAHMRTARP
DVVYSEFSLAAVIAARAEGIPCVGSASQPTTAAYASNPRKSAGIRRLLRDMGMPAPASSL
TVLEGMRRRFIPSCPTLEPRPGERAVYCGFLDEPPALTAKNRDCALVYLGAGSVPAGVAV
RAGRELAEALGCDVYVAGVPEATQVSGGYTVYCAPRFDVAELLPRACVFVHHGGQNSMMD
ALSYEVPQVIVPGRVFERQFNAEAVENARCGLTVRASRPVLIACAARRLVDEAALTSGIR
GLREELSLLGGTKRIVREVEKLIS

Enzyme Prediction     

No EC number prediction in MGYG000001441_01551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	49	382	1.6e-22	0.8769633507853403

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	2.13e-21	1	383	2	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	6.01e-20	1	382	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
TIGR00661	MJ1255	1.00e-05	115	331	89	294	conserved hypothetical protein. This model represents nearly the full length of MJ1255 from Methanococcus jannaschii and of an unpublished protein from Vibrio cholerae, as well as the C-terminal half of a protein from Methanobacterium thermoautotrophicum. A small region (~50 amino acids) within the domain appears related to a family of sugar transferases. [Hypothetical proteins, Conserved]
pfam13579	Glyco_trans_4_4	0.002	15	191	1	143	Glycosyl transferase 4-like domain.
cd03801	GT4_PimA-like	0.003	2	383	1	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT36430.1	2.01e-245	8	383	1	376
QGS11935.1	5.25e-241	8	384	1	377
AHF25143.1	3.01e-123	1	383	13	405
BAR06867.1	7.22e-92	1	384	1	384
BAR05900.1	2.34e-90	1	377	29	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OTG_A	3.74e-10	109	377	120	401	CrystalStructure of CalG1, Calicheamicin Glycostyltransferase, TDP bound form [Micromonospora echinospora],3OTH_A Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora],3OTH_B Crystal Structure of CalG1, Calicheamicin Glycostyltransferase, TDP and calicheamicin alpha3I bound form [Micromonospora echinospora]
4RIG_A	4.44e-08	24	383	20	373	ChimericGlycosyltransferase LanGT2S8Ac [Streptomyces fradiae],4RIG_B Chimeric Glycosyltransferase LanGT2S8Ac [Streptomyces fradiae],4RIH_A Chimeric Glycosyltransferase LanGT2S8Ac, carbasugar substrate complex [Streptomyces cyanogenus],4RIH_B Chimeric Glycosyltransferase LanGT2S8Ac, carbasugar substrate complex [Streptomyces cyanogenus],4RII_A Chimeric Glycosyltransferase LanGT2S8Ac, TDP complex [Streptomyces cyanogenus],4RII_B Chimeric Glycosyltransferase LanGT2S8Ac, TDP complex [Streptomyces cyanogenus]
4RIE_A	1.39e-07	24	383	20	373	LandomycinGlycosyltransferase LanGT2 [Streptomyces cyanogenus],4RIE_B Landomycin Glycosyltransferase LanGT2 [Streptomyces cyanogenus],4RIF_A Landomycin Glycosyltransferase LanGT2, carbasugar substrate complex [Streptomyces cyanogenus],4RIF_B Landomycin Glycosyltransferase LanGT2, carbasugar substrate complex [Streptomyces cyanogenus]
6KQW_A	3.34e-07	281	380	282	382	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	3.38e-07	281	380	282	382	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34539	1.85e-06	281	380	282	382	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001441_01551.