CAZyme Information: MGYG000001441_02045

Basic Information

• Species: Pauljensenia sp000411415
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp000411415
• CAZyme ID: MGYG000001441_02045
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
757		80837.9	4.6037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001441	2428388	Isolate	not provided	not provided

• Gene Location: Start: 435643; End: 437916 Strand: -

Full Sequence      

MTLRHYGRALAAASGAVLLCATLSVPALATPTSDTGAATPVTASVTDEGSAPITVTVART
DSHGDKVYEGDLITITVTYTNNTDSALTVFPVASNLSGVLTTGAPNCRWHNLAAHTTKQC
TTATHTVTADDVAAGTFTPMTTWAATRDRNGTDVIAGDITANADTVTVAQGERPPAPDPL
ETPHDYAIGEKVRLASPGLAGFSCHRIPALTTANNGWIIAAWDGRPNTCQDAPQANSIVY
RISKDGGKSWTPIQTALAGTPGAEKVGYSDPSFVVDRSTGTIFLFSVKSYDAGLFQSQLG
TDPAARNILHAHVVESHDNGETWVNPRTITDQVTAGHTDQWFTRFASSGEGIQLRYGAHA
GRLIQQYAVANSGTTSLMAVSVYSDDHGATWKPGAPTESSADENKVVELSDGRLLLNSRT
QGTAGQRLEAISYDGGQTWGPFRHNWDLTDPRNNASIVRAYPDAPEGSARARVLLFSNAD
SSSARANGTIRVSYDDGFTWNDGTVFESGEMAYSTLHPLGDGTWGLLYESGGYKNIEFMR
VDASYLGLTDPGEEPAPEPTPDPQPAPDPQPAPDPQPAPDPTPDPQPAPEPAPAVTPAHW
VNTGNGWKWQLEDSSYATNQTITIGEATYRFGADGMMVTGWDNQGGVWSYYNAYGARVSG
WIHDGAWYYLDPTTGAMATGWAQVGGTWYLFNASGAMLTGWQYAGSWYYLAPSGAMLTGW
QHIGSTWYYFAGDGHMVTGWQSVDGRWYFFAPSGAWI

Enzyme Prediction     

No EC number prediction in MGYG000001441_02045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	191	540	2.2e-88	0.9736842105263158

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.52e-93	192	542	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
NF033930	pneumo_PspA	2.61e-44	629	755	453	580	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	5.48e-41	639	755	486	603	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
COG4409	NanH	3.30e-39	194	522	264	635	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
NF033930	pneumo_PspA	9.89e-39	600	755	485	641	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT36491.1	0.0	1	757	1	751
QGS10752.1	0.0	1	654	1	636
QQC44728.1	0.0	1	652	1	621
AKU65858.1	0.0	1	652	1	621
AOZ72269.1	7.07e-181	53	557	41	549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	4.29e-117	174	547	2	360	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1EUT_A	7.25e-114	174	547	2	360	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	5.36e-112	178	547	2	356	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	1.06e-111	178	547	2	356	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]
1W8N_A	1.49e-111	178	547	2	356	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	9.11e-113	168	547	38	402	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P31206	4.88e-30	143	541	145	537	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
P29767	2.73e-23	180	546	370	826	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
Q4WQS0	1.77e-18	184	546	32	400	Exo-alpha-sialidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G13800 PE=1 SV=2
P62575	1.25e-15	316	529	541	768	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000309	0.998424	0.000584	0.000304	0.000185	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001441_02045.