CAZyme Information: MGYG000001443_00398

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_00398
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412		45022.69	4.6505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 530554; End: 531792 Strand: -

Full Sequence      

MLPCMSAYHIAFLPFPAFGHINTTLPVVAELVRRGHRVTFATNSRFASLVAGTGATVLEY
ESWLASRELPEEMDADYMAHEPVRSIDEAIATVPVYEAGFGDDVPDVLLYDVSTFAAGRV
LARKWRRPGIELFATFASNEHYSLTRQVGELYAGQIDPEHPALYDFFVKQGRLLKEHGLE
DVTLEEFNAPADDANIVFLPRRFQPAEETFGNGFAFVGACIGERGERAPWDPPANGRPLL
LVATGSFSFGYQREFLRTCVEAAADTGWHVVVSAGPLADSDDFADVPDNVELHRWVPQLE
VLERADAFVSHAGMNSVMEAMYFGTPVVAVPHTPEQRLIAARLQELGLGAHLPRGEVTGE
RLYEAVNRVSGDADTRARVRSLGEAMRAAGGPVAAADYVETIAARGMAGRDS

Enzyme Prediction     

No EC number prediction in MGYG000001443_00398.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	13	403	2e-48	0.9842931937172775

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	2.21e-130	15	405	3	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
cd03784	GT1_Gtf-like	3.87e-66	8	400	1	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	9.54e-59	8	410	2	406	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03785	GT28_MurG	3.35e-16	224	404	169	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PHA03392	egt	8.21e-11	279	387	337	447	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID34913.1	3.08e-306	1	412	1	412
AKA59102.1	3.32e-177	10	400	1	393
AHH99918.1	6.13e-117	5	400	11	402
AHH95830.1	3.27e-115	5	400	1	395
AHH98077.1	1.76e-114	6	401	8	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IYA_A	1.25e-94	9	404	14	421	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3RSC_A	5.83e-84	9	405	22	414	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3IAA_A	6.00e-84	9	405	22	414	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora],3IAA_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora]
6KQW_A	1.14e-82	5	400	1	382	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.32e-82	5	400	1	382	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65JC2	7.28e-83	5	404	1	391	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
O34539	7.21e-82	5	400	1	382	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q9XC67	6.97e-70	9	400	60	454	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1
Q53685	2.80e-63	9	400	9	395	Oleandomycin glycosyltransferase OS=Streptomyces antibioticus OX=1890 GN=oleD PE=1 SV=1
Q54387	3.90e-59	9	406	24	418	Macrolide glycosyltransferase OS=Streptomyces lividans OX=1916 GN=mgt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999835	0.000218	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_00398.