CAZyme Information: MGYG000001443_00442

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_00442
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	MGYG000001443_1|CGC6	44869.9	4.8573

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 683886; End: 685133 Strand: +

Full Sequence      

MTTKHVAVFVFPGYGHVNPTLEISRCLIALGHRVSYVLDEKLAAPVTALGAEVVPYSSRR
GRLGAGAVTGEDIGALGLGFLRESMEVILPLALESFDDDVPDLILYDLESFFTARTAAQR
WGRPTVQLFPYVATNEHYSLALEVFDEASESMHKCVELVTEHLAREGKGQDAVWSLMAGI
DDRNLVLLPREFQPRGETFDSRFAFTGHSLPADRPGTGSWDRPAGDGPVALVTLGTEVND
RPEFFRTCAEGFADSDWHLVMTTGPGNLPACRQAVAEAGAAARPAGIELHEWLAYNTVLP
HVSAVVCNSGISTMLEALSFGKPLVVITYTPEDRVNGRRTAELGLGVELPGEEVTAGRLR
EAVETVTHSPDIRRGVARMRMNMMAAGGPARAAQLVEGWLSEPATAPEPERAAVR

Enzyme Prediction     

No EC number prediction in MGYG000001443_00442.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	24	399	6.7e-40	0.9345549738219895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	4.07e-99	9	402	1	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
cd03784	GT1_Gtf-like	3.79e-49	5	399	2	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	3.22e-43	4	397	2	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03785	GT28_MurG	5.11e-08	15	397	11	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00201	UDPGT	2.10e-06	208	379	254	418	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID34940.1	1.30e-304	1	415	1	415
AKA59085.1	3.52e-158	4	402	5	399
AXK36634.1	1.53e-96	4	401	2	400
QIQ28614.1	2.50e-96	4	401	18	416
QTZ95667.1	1.64e-93	1	402	7	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RSC_A	5.37e-72	5	401	22	413	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3IAA_A	5.51e-72	5	401	22	413	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora],3IAA_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora]
3IA7_A	4.53e-70	4	400	5	397	CrystalStructure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora],3IA7_B Crystal Structure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora]
5DU2_A	7.15e-70	6	401	29	416	Structuralanalysis of EspG2 glycosyltransferase [Actinomadura verrucosospora],5DU2_B Structural analysis of EspG2 glycosyltransferase [Actinomadura verrucosospora]
2IYA_A	3.95e-62	1	402	10	422	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9XC67	6.09e-64	5	401	60	458	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1
Q65JC2	1.73e-54	1	401	1	391	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
O34539	9.00e-53	1	404	1	389	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q53685	6.47e-50	2	400	6	398	Oleandomycin glycosyltransferase OS=Streptomyces antibioticus OX=1890 GN=oleD PE=1 SV=1
Q54387	2.26e-42	1	401	18	414	Macrolide glycosyltransferase OS=Streptomyces lividans OX=1916 GN=mgt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_00442.