CAZyme Information: MGYG000001443_01079

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_01079
• CAZy Family: GT1
• CAZyme Description: O-mycaminosyltylonolide 6-deoxyallosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	MGYG000001443_1|CGC9	44113.84	11.6027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 1379053; End: 1380318 Strand: +

Full Sequence      

MRVAVMTAGSRGDIAPYTGLAHGLARAGHRVTVATHASFGPLVTAAGVELCPLPVDPRAE
LESARGRALHESTTGPGKLLRLTRMARELVGGMAPPLVDLARRSDLLLLSSSLAPLGNAI
GEGLGVPSAGVFLQPLHSTAAFSPSVLGARSFGPVGNRLAGRMTNEAVDRVFSQAVRTTV
RDLLSLPPAAARAARHRARERRGWPVWHGFSPVLVPRPRDWRPGLEVCGYWWPYDPPDAR
LPRHVEEFLAAGPPPVFVGLGSATVPDAEATGALVVRALRKAGLRGVVQRGWAGLHADDG
PDLLTVDEVPHALLFPRTAAVVHHCGAGTTGAGLRAGVPAVPVPVQFDAGFWAARLVASG
VAPAVVPLRRLTADRLAAALTAAVRDPSYGRCARRVAARLDAEDGTAAVVRAVERLAARR
G

Enzyme Prediction     

No EC number prediction in MGYG000001443_01079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	15	418	9.4e-50	0.9790575916230366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	3.91e-47	1	416	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	4.27e-40	1	421	2	403	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	2.61e-07	6	419	1	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam03033	Glyco_transf_28	1.06e-05	3	57	1	57	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
PLN03007	PLN03007	0.002	285	409	345	461	UDP-glucosyltransferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID39959.1	4.35e-298	6	421	1	416
QHF94283.1	1.69e-200	6	413	1	418
QNF58157.1	1.38e-199	6	413	1	418
SHH56086.1	1.72e-175	6	416	1	408
AVV47697.1	3.73e-174	6	416	1	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.73e-31	2	413	21	435	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.37e-31	2	413	41	455	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	1.68e-29	1	385	1	355	ChimericGlycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1PN3_A	1.32e-24	1	384	1	356	CrystalStructure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]
1IIR_A	6.92e-24	1	391	1	374	CrystalStructure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9XIG1	1.98e-49	1	415	156	572	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
Q9M8Z7	1.69e-46	1	412	193	605	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
O70023	3.85e-43	1	405	1	400	O-mycaminosyltylonolide 6-deoxyallosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylN PE=1 SV=2
Q5B4C9	7.79e-38	1	415	896	1311	Sterol 3-beta-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=atg26 PE=3 SV=1
P0CN90	8.94e-37	1	415	1034	1461	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000007	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_01079.