CAZyme Information: MGYG000001443_01132

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_01132
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000001443_1|CGC11	34335.02	7.5339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 1427304; End: 1428308 Strand: +

Full Sequence      

MTVRRTAAGIVALGIVPLALAVAPAGPAAAHGSMADPVSRVSTCFAEGPESPRSAACKAA
VAASGKQAFYDWNEVNIPDAAGKHRQIIPDGKLCSAGRDKYKGLDLARTDWPATAMKAGK
HTFRYKATAPHKGTFELYLTKDGYDPSKPLKWSDLEAKPFAKATDPQLRDGSYVIDATVP
QRSGRHLVYSIWQRSDSPEAFYTCSDVTFGGKGTAAGQQTPAAPDEQQIAAGRAKSTVDH
SGHGGDGSDNGETPGHATHGEAAPHQDHDGTAPGEAAADTDGPAPQGGARSADLAETGGD
GNTAPFAIGGAAVLAAGAGLLFVTARRRAGRSRG

Enzyme Prediction     

No EC number prediction in MGYG000001443_01132.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	31	207	1.1e-49	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03067	LPMO_10	1.64e-71	31	207	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd21177	LPMO_AA10	6.93e-65	31	208	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
COG3397	COG3397	2.91e-50	6	224	11	222	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
PRK13211	PRK13211	9.46e-21	89	215	70	199	N-acetylglucosamine-binding protein GbpA.
PHA03387	gp37	1.33e-19	85	209	104	250	spherodin-like protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID35558.1	1.85e-238	1	334	1	334
QHF94223.1	1.46e-164	1	334	1	336
QNF58096.1	4.18e-164	1	334	1	336
CDR12343.1	2.92e-142	2	334	6	351
AQW49820.1	2.00e-141	2	334	6	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IF7_A	1.48e-80	31	209	1	182	CrystalStructure of AA10 Lytic Polysaccharide Monooxygenase from Tectaria macrodonta [Tectaria macrodonta]
5FJQ_A	6.04e-41	31	210	1	180	Structuraland functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in Cellvibrio japonicus [Cellvibrio japonicus],5FJQ_B Structural and functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in Cellvibrio japonicus [Cellvibrio japonicus],5FJQ_C Structural and functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in Cellvibrio japonicus [Cellvibrio japonicus]
4OY7_A	1.36e-30	31	211	1	195	Structureof cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_B Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_C Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_D Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_E Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_F Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_G Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_H Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)]
5OPF_A	1.56e-23	31	210	1	194	Structureof LPMO10B from from Micromonospora aurantiaca [Micromonospora aurantiaca ATCC 27029]
5WSZ_A	8.42e-21	45	207	3	164	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02I11	2.30e-72	13	211	8	211	Chitin-binding protein CbpD OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=cpbD PE=1 SV=1
Q9I589	2.30e-72	13	211	8	211	Chitin-binding protein CbpD OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cbpD PE=1 SV=1
A3KKC4	2.74e-32	26	217	30	236	Lytic cellulose monooxygenase OS=Streptomyces ambofaciens (strain ATCC 23877 / 3486 / DSM 40053 / JCM 4204 / NBRC 12836 / NRRL B-2516) OX=278992 GN=SAM23877_1271 PE=1 SV=1
A1JQE6	4.35e-15	26	211	17	194	GlcNAc-binding protein A OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=gbpA PE=3 SV=1
Q8GBD4	4.35e-15	26	211	17	194	GlcNAc-binding protein A OS=Yersinia enterocolitica OX=630 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000257	0.999094	0.000150	0.000200	0.000151	0.000138

TMHMM  Annotations     

start	end
7	29
303	325