CAZyme Information: MGYG000001443_01184

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_01184
• CAZy Family: GH15
• CAZyme Description: Trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608	MGYG000001443_1|CGC13	68233.97	4.8047

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 1489876; End: 1491702 Strand: +

Full Sequence      

MAGRIEDYALIGDMQTAALVSKDGTVDWLCLPRFDSHAVFAGLLGTEEHGFWRVGPAHPA
GGDPPRADRRRYRGDSLVLETEWDTPRGTVRIIDFMPPREQHAPQLVRIVEGVSGRVRMR
SSLRMRFSYGWVVPWVHKIGQRTVAVAGPDSVWLDTEADTYGKDLTTYSDFTVGPGDRVA
LTISWEASHKQPPPLPEPEEALRTTEDFWREWVETCTYHGPYREAVVRSLITLKALTYAP
TGGIVAAPTTSLPEEIGGERNWDYRFTWLRDAAITLSSLLRTGYREEARAWREWLLRAVA
GDPENLQIMYGIAGERELSEAELSWLPGYEGSTPVRVGNGAAGQLQLDVYGEVVEALHLG
HMTGLARNDYAQLLQLKLIGYLEDHWDEPDEGIWEVRGPRRHFVHSKVMAWVAVDRTVKL
IESGDVDGPLERWRNLRDEIHREVCEKGYDKERNTFTQSYGSKELDASLLLIPQMGFLPP
DDKRVIGTIEAIQRELSTEDGFVLRYPTSAEAGPDGKPCENVDGLSGEEGAFLACSFWLA
DDLAMIGRVDEARKLFERLLALRNDVGLLAEEWDPVRQRLVGNFPQAFSHVPLIDTALRL
TASGAYGV

Enzyme Prediction     

No EC number prediction in MGYG000001443_01184.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	223	597	7.9e-83	0.9916897506925207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3387	SGA1	1.19e-135	4	602	15	606	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
pfam00723	Glyco_hydro_15	2.56e-114	220	598	1	417	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
TIGR01577	oligosac_amyl	1.23e-14	228	600	260	613	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID35605.1	0.0	1	608	3	610
QHF94191.1	0.0	1	608	3	609
QNF58062.1	0.0	1	608	3	609
QDL73655.1	0.0	1	607	3	601
QPI55511.1	0.0	1	607	3	601

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71741	5.07e-128	5	600	54	660	Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2402 PE=1 SV=2
A0R0W9	1.23e-125	5	600	42	648	Trehalase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4535 PE=1 SV=1
Q978S7	2.02e-121	4	600	29	610	Trehalase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG1381191 PE=1 SV=1
Q9HLE2	3.20e-118	19	600	2	568	Trehalase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0286 PE=1 SV=1
Q10211	5.41e-98	5	597	19	636	Uncharacterized protein C4H3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.03c PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_01184.