CAZyme Information: MGYG000001443_01898

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_01898
• CAZy Family: CBM16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		39625.01	10.9282

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2316028; End: 2317158 Strand: -

Full Sequence      

MTGTPTPRSRPPRTHLLRALALPLLGLALLGASLPAAGQDRPVGRHHGGEHLAAVPVPVR
DGARGGGASRVARPAVSPYLSLGWGDPPAPGVLLRATGVDGFTFAFVLSAGHCEPRWDGV
RPLRGGADERAVRAVRAAGGEPVVSFGGGTGRKLEQDCADAAALAGAYRKVIGAYGLRAI
DVDIETSAYASAAARRKTVEALARLRAAEPGLTVHVTLPSGRTGPDARLIDAAARAGVEP
DSWTIMPFAFGSPPRNEAEVQEARRVDMARATVRAAEGLAARLRSAYGYDEATAWAHSGI
STMNGITGHQEVLGPGDFRVIARFARAHGLARLAFWSVNRDRPCGGLPYPAQDRCSGVPQ
RPWEFTRALTRPERPR

Enzyme Prediction     

No EC number prediction in MGYG000001443_01898.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06543	GH18_PF-ChiA-like	1.51e-86	74	370	1	294	PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain. Members of this domain family are found not only in archaea but also in eukaryotes and prokaryotes. PF-ChiA exhibits hydrolytic activity toward both colloidal and crystalline (beta/alpha) chitins at high temperature.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID36187.1	3.61e-266	1	376	1	375
QPP09071.1	8.54e-122	75	369	68	353
AXK34915.1	7.78e-112	75	369	45	330
QFR97484.1	4.46e-109	26	369	4	322
AQW54718.1	6.46e-105	68	371	49	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2DSK_A	1.83e-18	77	343	13	265	Crystalstructure of catalytic domain of hyperthermophilic chitinase from Pyrococcus furiosus [Pyrococcus furiosus],2DSK_B Crystal structure of catalytic domain of hyperthermophilic chitinase from Pyrococcus furiosus [Pyrococcus furiosus]
3A4W_A	1.16e-17	77	343	13	265	Crystalstructures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus],3A4W_B Crystal structures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus]
3A4X_A	2.15e-17	77	343	13	265	Crystalstructures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus],3A4X_B Crystal structures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus],3AFB_A Crystal structures of catalytic site mutants of active domain 2 of chitinase from Pyrococcus furiosus [Pyrococcus furiosus],3AFB_B Crystal structures of catalytic site mutants of active domain 2 of chitinase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14529	6.89e-85	75	369	42	321	Chitinase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=chiA2 PE=1 SV=2
P13656	4.34e-11	77	345	590	867	Probable bifunctional chitinase/lysozyme OS=Escherichia coli (strain K12) OX=83333 GN=chiA PE=1 SV=2
O74199	1.64e-06	77	343	239	511	Endochitinase 11 OS=Metarhizium anisopliae OX=5530 GN=chi11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.053795	0.941179	0.002751	0.001423	0.000502	0.000349

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_01898.