CAZyme Information: MGYG000001443_02173

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_02173
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		40199.6	9.8714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2629919; End: 2631082 Strand: -

Full Sequence      

MVPPTTPDGDGQRAPGAHGDAAGPWGVADAPGTRCGGAAYDGTPGPHDATGESPAPAGPP
SGDAPDAPHGGASRGSGRGVRDKAPPVPAGQTGRRPSGGSLREQLGVVIATRDRQRTLAA
TLERLLALPEEPRVLVVDNASRDGTAAMVTRSFPGVQLLRLPVNRGALARNEGVKALRTP
YVAFSDDDSWWEPGALRTAVDILAARPATGLLAAGITVGDEGRPDPLNSVLAASPLGDGS
APGSRRVLGFLGCAAVVRRHAYLDVGGYHPLLFFGAEETLLAYDLAAAGWEVIHCPQVVA
RHSPADAPRPGRQALVRRNELLIAWLRRPLPVALRRTAALCGDALHDPGARRAARELLPR
LPAALRHRRPLPPPVERAARLVEGAPA

Enzyme Prediction     

No EC number prediction in MGYG000001443_02173.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	107	262	3.6e-21	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	5.98e-28	107	302	1	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	3.36e-23	107	262	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.15e-19	107	294	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1216	GT2	3.40e-17	105	381	5	299	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06439	CESA_like_1	6.74e-14	107	309	33	235	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID36407.1	2.81e-278	1	387	1	387
QNF58637.1	3.37e-147	96	385	39	330
QHF94738.1	4.77e-147	88	385	31	330
CQR60951.1	4.33e-124	94	387	11	304
QCR50300.1	1.57e-123	105	383	26	304

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	2.43e-08	122	358	18	300	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	2.43e-08	122	358	18	300	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P33700	1.23e-07	107	294	11	211	Succinoglycan biosynthesis protein ExoU OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoU PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994125	0.005823	0.000067	0.000010	0.000005	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_02173.