CAZyme Information: MGYG000001443_02195

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_02195
• CAZy Family: GH23
• CAZyme Description: Resuscitation-promoting factor Rpf

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
239	MGYG000001443_1|CGC24	24766.5	9.9871

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2654025; End: 2654744 Strand: +

Full Sequence      

MLFSGKGRHRRPTKAVRIATLTGVAGAAVAIPLVSATGAQAASVDTWDKVAQCESSGNWH
ANTGNGYYGGLQFNNSSWAAAGGTKYAPRADLATKDQQIAVAEKLLQMQGPGAWSCAGAG
GLTSGGPAADVHPDGGSAQQAQPRQQAAPKPAQPRQQTQPQQQAAPKPAQPKPAQPKPAQ
PQQQAPRTGHGNYTVKPGDTLSEIAQAHGTDWHKVYADNKSTIGDDADLIFPGQKLQIG

Enzyme Prediction     

No EC number prediction in MGYG000001443_02195.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06737	Transglycosylas	1.23e-32	45	117	3	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
cd13925	RPF	1.55e-25	45	116	1	70	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
cd00118	LysM	3.09e-12	193	238	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.93e-10	193	238	2	44	Lysin motif.
pfam01476	LysM	2.45e-10	193	238	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID36423.1	3.43e-150	1	239	1	239
QNF57179.1	1.42e-115	1	239	1	232
QHF93397.1	5.50e-113	1	239	1	232
AOP45477.1	5.19e-92	6	238	5	221
QZY16416.1	1.72e-90	6	238	5	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4KL7_A	2.31e-24	47	114	3	70	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_A Chain A, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
4EMN_A	2.38e-24	47	114	4	71	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_B Chain B, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_C Chain C, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_D Chain D, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
1XSF_A	5.05e-24	47	114	31	98	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
3EO5_A	2.70e-23	47	114	94	161	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
5E27_A	1.47e-22	47	114	171	238	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],5E27_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WG30	2.26e-25	7	120	3	117	Resuscitation-promoting factor RpfA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfA PE=3 SV=1
P9WG31	2.26e-25	7	120	3	117	Resuscitation-promoting factor RpfA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfA PE=1 SV=1
Q6M6W5	1.58e-24	7	124	2	119	Resuscitation-promoting factor Rpf1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf1 PE=3 SV=1
H8EZH5	4.29e-21	47	114	285	352	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfB PE=2 SV=1
P9WG29	4.29e-21	47	114	285	352	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000363	0.998835	0.000169	0.000253	0.000180	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_02195.