CAZyme Information: MGYG000001443_02605

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_02605
• CAZy Family: GH18
• CAZyme Description: Chitinase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000001443_5|CGC1	35357.56	4.633

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 166746; End: 167777 Strand: -

Full Sequence      

MARTRRRSLLRTLASLAASTLAVGGMAVLGPASAHAAGGAPPAGPGPHVGASQVPAHAVT
GYWQNFDNGATVQTLAEVQDEYDIIAVAFADATGSPGQVDFNLDPALGYSEEQFKADIAA
KHAEGKSVIISVGGEKGTVSVADDASAKAFSDSIVKLMDEYGFDGVDIDLENGLNSTYMT
KALDAIHAAKSDVVVTMAPQTIDMQSPSNEYFKTALNIKSYLTVVNMQYYNSGSMNGCDG
KVYSAGTVDFLTALACVQIKGGLDPSQVGLGTPASPRAAGSGYVDPGVVNAALDCLAEGT
GCGSFVPDQKWPGIRGAMTWSTAWDAANGNKWSSTVGPHVHAM

Enzyme Prediction     

No EC number prediction in MGYG000001443_02605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	58	312	3.9e-24	0.6993243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02871	GH18_chitinase_D-like	1.07e-104	57	339	1	312	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
COG3469	Chi1	9.14e-39	61	337	30	322	Chitinase [Carbohydrate transport and metabolism].
pfam00704	Glyco_hydro_18	1.61e-22	61	325	7	307	Glycosyl hydrolases family 18.
smart00636	Glyco_18	3.81e-21	59	327	2	288	Glyco_18 domain.
cd02877	GH18_hevamine_XipI_class_III	8.57e-18	57	330	1	273	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID40322.1	1.05e-231	26	343	1	318
QHF98922.1	1.21e-196	11	343	4	337
QNF59632.1	1.21e-196	11	343	4	337
QPP10596.1	1.73e-175	51	343	34	327
QKV97606.1	3.28e-168	51	343	14	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EBV_A	2.32e-135	57	343	5	294	Crystalstructure of putative Chitinase A from Streptomyces coelicolor. [Streptomyces coelicolor]
5KZ6_A	3.07e-50	59	343	12	332	1.25Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis],5KZ6_B 1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis]
4TX8_A	1.75e-48	57	336	107	413	CrystalStructure of a Family GH18 Chitinase from Chromobacterium violaceum [Chromobacterium violaceum ATCC 12472]
3N11_A	6.54e-48	59	334	9	320	Crystalstricture of wild-type chitinase from Bacillus cereus NCTU2 [Bacillus cereus],3N12_A Crystal stricture of chitinase in complex with zinc atoms from Bacillus cereus NCTU2 [Bacillus cereus]
3N15_A	1.81e-47	59	334	9	320	Crystalstricture of E145Q chitinase in complex with NAG from Bacillus cereus NCTU2 [Bacillus cereus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27050	4.55e-47	61	343	194	514	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
Q05638	4.66e-44	45	335	252	591	Exochitinase 1 OS=Streptomyces olivaceoviridis OX=1921 GN=chi01 PE=1 SV=1
D4AVJ0	2.89e-39	74	325	16	313	Probable class II chitinase ARB_00204 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00204 PE=1 SV=2
A5FB63	1.33e-24	54	328	1139	1465	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
E9F7R6	6.89e-20	61	336	45	341	Endochitinase 4 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chi4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000869	0.000000	0.999126	0.000002	0.000000

TMHMM  Annotations     

start	end
13	35