CAZyme Information: MGYG000001443_03180

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_03180
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
278		30982.37	10.1931

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 792066; End: 792902 Strand: +

Full Sequence      

MTIKGIDVSSYQPERYSTRGLDFVIIKITEGTSYTNPKWVAQRKTARDAGLVTGFYHFVR
PGSMTAQANYFLSKINLVAGDFLVLDWEDPGVSNADKDAWIKHVQKKAPGHKVLLYCNVD
YWLNRDRTSFAGDGLWIAQYNGKPGKPSIQAPWVIHQYTSTPVDTNLAKFSTRDAMRKWA
GGKSTGKPKPKYEPFPGADFFMSGGKPALGKKSEIFTEMGKRLVAEGCSRYKVGPGPVLG
QADIDSYEAWQRKCGFRGKDATWPPGKTTWGRLKVPNT

Enzyme Prediction     

No EC number prediction in MGYG000001443_03180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	6	161	1.5e-38	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00599	GH25_muramidase	1.46e-41	4	168	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	3.86e-39	6	163	1	176	Glycosyl hydrolases family 25.
NF038080	PG_bind_siph	9.87e-29	195	275	1	76	peptidoglycan-binding domain. This domain occurs shows apparent homology to known or putative peptidoglycan-binding domains in families such as PF01471. The domain occurs once, or twice, at the C-terminus of proteins such as cell wall amidases. In particular, member proteins can be found among putative lysins of phage of Streptomyces from the Siphoviridae family, such as phiBT1.
cd06417	GH25_LysA-like	4.48e-28	3	175	1	194	LysA is a cell wall endolysin produced by Lactobacillus fermentum, which degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. The N-terminal glycosyl hydrolase family 25 (GH25) domain of LysA has sequence similarity with other murein hydrolase catalytic domains while the C-terminal domain has sequence similarity with putative bacterial cell wall-binding SH3b domains. This domain family also includes LysL of Lactococcus lactis.
cd06524	GH25_YegX-like	5.58e-26	4	167	1	191	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF57468.1	1.60e-113	3	180	5	182
BBB00619.1	2.57e-107	1	278	1	273
BBB00566.1	2.57e-107	1	278	1	273
QID39057.1	2.56e-104	3	186	2	185
BBB02142.1	3.42e-104	1	277	1	278

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X8R_A	2.11e-11	2	157	3	183	Thestructure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]
6ZMV_A	3.77e-11	3	161	2	164	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]
1H09_A	2.28e-09	20	181	26	199	ChainA, LYSOZYME [Streptococcus phage Cp1]
2IXU_A	2.29e-09	20	181	27	200	ChainA, LYSOZYME [Streptococcus phage Cp1]
2IXV_A	5.55e-09	20	181	27	200	ChainA, LYSOZYME [Streptococcus phage Cp1],2J8F_A Chain A, LYSOZYME [Streptococcus phage Cp1],2J8G_A Chain A, LYSOZYME [Streptococcus phage Cp1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00721	8.75e-16	2	122	1	144	N,O-diacetylmuramidase OS=Chalaropsis sp. OX=36534 PE=1 SV=1
P34020	4.44e-10	3	161	1	165	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
D4ANU4	1.02e-09	2	158	29	205	N,O-diacetylmuramidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05911 PE=1 SV=1
P15057	1.25e-08	20	181	27	200	Lysozyme OS=Streptococcus phage Cp-1 OX=10747 GN=CPL1 PE=1 SV=2
P19385	1.04e-06	4	167	15	185	Lysozyme OS=Streptococcus phage Cp-7 OX=10748 GN=CPL7 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_03180.