CAZyme Information: MGYG000001443_04645

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_04645
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
179	MGYG000001443_5|CGC26	18916.37	9.2466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2522869; End: 2523408 Strand: -

Full Sequence      

MRTTTLIPRRIATTGITVLGAAGIATAALTGTAHAAPQTAKPAHQTAAKAAAKPVKADDK
TDKKDAGKKAEDYPDNLDGWIREAMSIMKKHGIPGSYDGIKRNIIRESGGDPGAVNDWDI
NAQKGIPSKGLLQVIQPTFDQYHVKGTADKLTDPVANIVAACNYAADRYGTMDNVDSAY

Enzyme Prediction     

No EC number prediction in MGYG000001443_04645.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13402	LT_TF-like	2.19e-29	98	171	2	74	lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG3953	SLT	7.29e-17	81	175	1	94	SLT domain protein [Mobilome: prophages, transposons].
pfam01464	SLT	1.53e-04	104	174	18	83	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	0.006	104	164	7	59	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam18896	SLT_3	0.007	107	171	24	82	Lysozyme like domain. This entry represents a lysozyme like domain found in candidate phyla radiation bacteria. The domain contains several conserved cysteine and histidine residues suggesting that it may bind to zinc.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID39568.1	8.31e-117	1	179	1	179
QID34829.1	1.93e-103	1	179	1	186
QID34458.1	5.82e-102	1	179	1	183
QID39180.1	1.85e-101	1	179	1	186
QID34892.1	2.79e-79	13	179	11	214

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54334	1.26e-12	76	175	1093	1189	Phage-like element PBSX protein XkdO OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdO PE=4 SV=2
P45931	1.27e-12	76	175	1345	1441	Uncharacterized protein YqbO OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000995	0.997577	0.000237	0.000676	0.000271	0.000208

TMHMM  Annotations     

start	end
13	35