CAZyme Information: MGYG000001443_04741

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_04741
• CAZy Family: GH46
• CAZyme Description: Chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281		30682.09	5.4142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2626822; End: 2627667 Strand: -

Full Sequence      

MSSFDSTSRPGSLRRRTALAFLGASLTAVPLLSAAHPPAASAAGKGAGLDDPAKKEIAMQ
LVSSAENSSLDWKAQYKYIEDIGDGRGYTAGIIGFCSGTGDMLDLVELYTDRKPGNVLAE
YLPALRRVNGSDSHEGLDPHYPDDWRTAARDKAFQQAQNDERDRVYFDPAVKQGKADGLR
ALGQFAYYDALVMHGGGDDATSFGSIRKRALRRAKPPAAGGDEKTYLNAFLDARVWAMEQ
EEAHSDTSRVETAQRVFLREGNFALEPPLDWKVYGDSYHID

Enzyme Prediction     

EC	3.2.1.132

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH46	48	265	4.5e-90	0.990990990990991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01374	Glyco_hydro_46	2.24e-142	60	269	1	210	Glycosyl hydrolase family 46. This family are chitosanase enzymes.
cd00978	chitosanase_GH46	7.88e-106	52	269	1	222	chitosanase belonging to the glycosyl hydrolase 46 family. This family is composed of the chitosanase enzymes which hydrolyzes chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Chitosanases play a role in defense against pathogens such as fungi and are found in microorganisms, fungi, viruses, and plants. Microbial chitosanases can be divided into 3 subclasses based on the specificity of the cleavage positions for partial acetylated chitosan. Subclass I chitosanases such as N174 can split GlcN-GlcN and GlcNAc-GlcN linkages, whereas subclass II chitosanases such as Bacillus sp. no. 7-M can cleave only GlcN-GlcN linkages. Subclass III chitosanases such as MH-K1 chitosanase are the most versatile and can split both GlcN-GlcN and GlcN-GlcNAc linkages.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID39641.1	3.46e-205	1	281	1	281
AZP22132.1	1.96e-154	10	280	4	271
CCK25255.1	2.41e-154	15	280	6	267
ALV31577.1	2.71e-154	15	280	14	280
QUC63506.1	5.62e-154	15	280	9	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ILY_A	1.11e-140	30	280	3	249	Abundantlysecreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E],4ILY_B Abundantly secreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]
1CHK_A	1.54e-128	46	281	2	237	StreptomycesN174 Chitosanase Ph5.5 298k [Streptomyces sp. N174],1CHK_B Streptomyces N174 Chitosanase Ph5.5 298k [Streptomyces sp. N174]
4OLT_A	1.00e-100	49	281	16	248	Chitosanasecomplex structure [Pseudomonas sp. LL2(2010)],4OLT_B Chitosanase complex structure [Pseudomonas sp. LL2(2010)]
4QWP_A	1.65e-99	49	281	16	248	co-crystalstructure of chitosanase OU01 with substrate [Pseudomonas sp. A-01],4QWP_B co-crystal structure of chitosanase OU01 with substrate [Pseudomonas sp. A-01]
7C6C_A	1.01e-38	47	269	1	229	ChainA, Chitosanase [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33665	3.12e-130	14	281	4	277	Chitosanase OS=Streptomyces sp. (strain N174) OX=69019 GN=csn PE=1 SV=1
P48846	2.91e-121	13	281	3	277	Chitosanase OS=Nocardioides sp. (strain N106) OX=47919 GN=csn PE=3 SV=1
O07921	1.34e-37	47	269	36	264	Chitosanase OS=Bacillus subtilis (strain 168) OX=224308 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001416	0.482543	0.000560	0.512710	0.002583	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_04741.