CAZyme Information: MGYG000001443_04796

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_04796
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245	MGYG000001443_5|CGC28	26590.81	6.2324

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2680609; End: 2681346 Strand: +

Full Sequence      

MSRKRILAVLTAFVVGLGLWFGMPMTSQASPAKAGAKSKAAFVVSEAQFNQMFPDRNPFY
TYAGLTQALDAYPEFATTGDEAMQKREAAAFLANVSHETGGLKYIKEQNEANYPHYCDAS
QPYGCPAGQDAYYGRGPIQLSWNFNYKAAGDALGIDLLNDPFKVENDPAVAWKTGLWYWN
TQQGPGTMTPHNAIVTGAGFGETIRAINGTLECNGGNPGQVQSRIDNFKRFTQILGTTTG
DNLSC

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	43	245	7.2e-74	0.9653679653679653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	2.26e-89	44	245	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	5.29e-60	43	245	1	232	Chitinase class I.
COG3179	COG3179	5.12e-09	44	181	4	164	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID39688.1	4.70e-185	1	245	1	245
AKA07547.1	2.66e-131	3	245	2	252
AIA07764.1	2.66e-131	3	245	2	252
ARH89153.1	3.91e-131	3	245	2	253
AZS69799.1	2.26e-130	3	245	2	253

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1WVU_A	5.38e-126	35	245	55	265	Crystalstructure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
1WVV_A	1.54e-125	35	245	55	265	ChainA, chitinase C [Streptomyces griseus],1WVV_B Chain B, chitinase C [Streptomyces griseus]
2CJL_A	2.10e-125	42	245	1	204	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
3WH1_A	7.48e-59	44	245	8	206	CrystalStructure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	1.03e-58	44	245	7	205	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24626	3.58e-52	30	245	66	311	Chitinase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht3 PE=2 SV=2
Q5NTA4	4.95e-52	27	245	67	281	Endochitinase 4 OS=Cryptomeria japonica OX=3369 PE=1 SV=1
P21226	2.22e-51	27	245	57	301	Endochitinase A2 OS=Pisum sativum OX=3888 GN=CHI2 PE=1 SV=2
P29022	6.03e-50	59	245	105	280	Endochitinase A OS=Zea mays OX=4577 GN=CHIA PE=1 SV=1
P06215	4.24e-49	36	245	72	309	Endochitinase OS=Phaseolus vulgaris OX=3885 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002033	0.995598	0.001111	0.000706	0.000287	0.000223

TMHMM  Annotations     

start	end
7	29