CAZyme Information: MGYG000001443_04863

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_04863
• CAZy Family: GT2
• CAZyme Description: D-alanine--poly(phosphoribitol) ligase subunit 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
954		101163.83	6.3706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2756266; End: 2759130 Strand: +

Full Sequence      

MDGTGRLCQALAVRLHKGADTERLRARLESRGGGARLWVEDFDEAADGPRATARRERELS
RPADPRSGPGLRAVLLRYADGTSDLIVVAHQAVLPEPYVLVRQLLGEHPPAADGLPGADA
PGGQPPQARTADRAERLRAALAELDRLPAPDWGLGTEGAATVGRHRFTVPAGGPAPAQLT
LRAALGLVLARCTGQSQVVVGAEAGTAVAFSADGAQSVTAYLEQVAGARPADDGPLVGLL
TTRTADVITGDGVKAEPFAARPFLDPPHALSLHIADDGSTVLEGRCAYRHAAFGDAAVEW
FTGMLATAHRALLTADPATPVGELPLFDEEQRAALARLGGLGRRPAVPGERIEETVGRRA
ATTPDAPAVCFGEIRLTYRELDGRAARFAARLRELGVAPGDRVGVCLDRSADLVVTLLAV
LKAGAAYVPMDPAYPAERLAYTTEDAGLSLVVTEAGGVPERDGLRLVSPAALDRPVALPQ
PAPAGLSADDAAYVIYTSGSTGRPKGVVVPHRNVAALLAATEEDFRLGGRDVWTLFHSSA
FDFSVWEIWGCLMTGGRLVVVPYWASRDPAQFAALLESEQVTVVSQTPSAFAQLMAADRE
RRVAGAVRLVVFGGEPLDTRPLRFWLDQHPERECRLVNMFGITETTVHVTAQTVTRREAL
AASRSVGRPLPGWHLYVLDPDGRPLPPGVAGEIHVGGAGVAGHYLNRPELTAQRFLPDPH
APGPMYRSGDRGRLLPDGRLEHLGRLDNQIKLRGFRIELDEIRSRLLEAPGVTAAAVVLR
QGQDGDSAGARLDAYVVLGTDAAHLPHGADGSEDRTEDGTARVRQHAARFLPEHMVPATV
TALPALPLTPNGKVDTGRLPLPLTGGPAGAGRAGPEPEADDVESRLRTVWEKVFGFRVGL
DDDFFSLGGNSLLGVRLLAALKAAGLPGFPLPQLYLHRTVRQLAPVLARQEVPA

Enzyme Prediction     

No EC number prediction in MGYG000001443_04863.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17643	A_NRPS_Cytc1-like	0.0	364	855	1	446	similar to adenylation domain of cytotrienin synthetase CytC1. This family of the adenylation (A) domain of nonribosomal peptide synthases (NRPS) includes Streptomyces sp. cytotrienin synthetase (CytC1), a relatively promiscuous adenylation enzyme that installs the aminoacyl moieties on the phosphopantetheinyl arm of the holo carrier protein CytC2. Also included are Streptomyces sp Thr1, involved in the biosynthesis of 4-chlorothreonine, Pseudomonas aeruginosa pyoverdine synthetase D (PvdD), involved in the biosynthesis of the siderophore pyoverdine and Pseudomonas syringae syringopeptin synthetase, where syringpeptin is a necrosis-inducing phytotoxin that functions as a virulence determinant in the plant-pathogen interaction. The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.
cd05930	A_NRPS	1.49e-177	364	859	1	444	The adenylation domain of nonribosomal peptide synthetases (NRPS). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester bond to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.
PRK12467	PRK12467	6.12e-154	313	951	1537	2167	peptide synthase; Provisional
PRK12467	PRK12467	3.46e-150	22	954	101	1104	peptide synthase; Provisional
cd12117	A_NRPS_Srf_like	7.50e-150	358	859	5	483	The adenylation domain of nonribosomal peptide synthetases (NRPS), including Bacillus subtilis termination module Surfactin (SrfA-C). The adenylation (A) domain of NRPS recognizes a specific amino acid or hydroxy acid and activates it as an (amino) acyl adenylate by hydrolysis of ATP. The activated acyl moiety then forms a thioester to the enzyme-bound cofactor phosphopantetheine of a peptidyl carrier protein domain. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and, in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions. This family includes the adenylation domain of the Bacillus subtilis termination module (Surfactin domain, SrfA-C) which recognizes a specific amino acid building block, which is then activated and transferred to the terminal thiol of the 4'-phosphopantetheine (Ppan) arm of the downstream peptidyl carrier protein (PCP) domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAY30132.1	6.16e-130	282	952	512	1185
BAZ00088.1	5.12e-129	222	952	450	1183
BAZ75991.1	5.12e-129	222	952	450	1183
BAY90071.1	2.17e-126	313	947	541	1177
AFY93865.1	4.60e-121	363	948	344	930

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6N8E_A	2.11e-111	222	947	391	1066	Crystalstructure of holo-ObiF1, a five domain nonribosomal peptide synthetase from Burkholderia diffusa [Burkholderia diffusa]
6P1J_A	2.24e-103	250	855	369	960	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae],6P1J_B The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae]
5N9W_A	2.04e-99	349	855	17	517	Structureof adenylation domain THR1 involved in the biosynthesis of 4-chlorothreonine in Streptomyces SP.OH-5093, apo structure [Streptomyces sp.],5N9W_B Structure of adenylation domain THR1 involved in the biosynthesis of 4-chlorothreonine in Streptomyces SP.OH-5093, apo structure [Streptomyces sp.],5N9X_A Structure of adenylation domain THR1 involved in the biosynthesis of 4-chlorothreonine in Streptomyces SP.OH-5093, ligand bound structure [Streptomyces sp.],5N9X_B Structure of adenylation domain THR1 involved in the biosynthesis of 4-chlorothreonine in Streptomyces SP.OH-5093, ligand bound structure [Streptomyces sp.]
3VNQ_A	8.49e-99	360	855	45	529	Co-crystalstructure of NRPS adenylation protein CytC1 with ATP from streptomyces [Streptomyces sp.],3VNR_A Co-crystal structure of NRPS adenylation protein CytC1 with aminobutyric acid and AMP from streptomyces [Streptomyces sp.],3VNS_A Co-crystal structure of NRPS adenylation protein CytC1 with D-valine and AMP from streptomyces [Streptomyces sp.]
6MFZ_A	2.87e-91	328	952	1203	1802	Crystalstructure of dimodular LgrA in a condensation state [Brevibacillus parabrevis],6MFZ_B Crystal structure of dimodular LgrA in a condensation state [Brevibacillus parabrevis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45745	6.48e-136	315	924	1480	2084	Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=dhbF PE=1 SV=4
Q52400	1.03e-128	345	922	16	581	Syringomycin synthase SyrB1 OS=Pseudomonas syringae pv. syringae OX=321 GN=syrB1 PE=1 SV=2
P39846	2.79e-119	270	944	1423	2073	Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) OX=224308 GN=ppsB PE=1 SV=1
Q70LM6	4.68e-101	288	946	4032	4670	Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis OX=54914 GN=lgrB PE=1 SV=1
Q70LM4	9.60e-96	251	947	1419	2093	Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis OX=54914 GN=lgrD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_04863.