CAZyme Information: MGYG000001443_05431

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_05431
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	MGYG000001443_6|CGC2	34251.08	9.867

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 618856; End: 619836 Strand: +

Full Sequence      

MRRKKVWLLAIGGGLGVLSLFVALLVVGTYVAAAGLFGVGGGAVSLAKGAVPAAYQQLIE
KWGNKCKALNPAVLAAQINQESGWNPKARSPANAQGIAQFIPGTWATHGVDANGDGRKDV
LDPEDAIPSAAMYDCKLAKYVKDAPGNVTDNMLAAYNAGPYAVIKYAGVPPYSETKNYVA
TIRKMAESFTAPTGRLNPTKAGAGAISFAQSKLGTPYLWGGNGTPEQGGRFDCSGLTKAA
YRTVGVTLPRVANDQYNTGPHPKRSELLPGDLVFFASDLTNSRSIHHVGIYVGGGKMINA
PYTGAKIRYDPIDTPDYFGATRPSAK

Enzyme Prediction     

No EC number prediction in MGYG000001443_05431.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	66	190	6.3e-30	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	6.47e-37	69	188	3	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam00877	NLPC_P60	3.93e-31	214	322	1	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
COG0791	Spr	9.90e-30	181	323	54	193	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	6.35e-27	71	184	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK13914	PRK13914	9.34e-23	197	312	361	466	invasion associated endopeptidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNF56063.1	1.10e-190	3	325	5	328
QHF97822.1	4.49e-190	3	325	5	328
QEV22383.1	4.14e-176	4	322	2	320
AZM57740.1	3.39e-175	4	322	2	320
QES39142.1	4.58e-173	4	322	2	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CFL_A	1.74e-22	206	306	18	115	ChainA, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_B Chain B, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_C Chain C, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile],7CFL_D Chain D, Putative cell wall hydrolase phosphatase-associated protein [Clostridioides difficile]
3H41_A	3.47e-18	198	317	185	299	CRYSTALSTRUCTURE OF A NLPC/P60 FAMILY PROTEIN (BCE_2878) FROM BACILLUS CEREUS ATCC 10987 AT 1.79 A RESOLUTION [Bacillus cereus ATCC 10987]
3PBI_A	3.47e-17	195	312	78	199	ChainA, Invasion Protein [Mycobacterium tuberculosis]
3I86_A	9.29e-17	211	315	21	129	Crystalstructure of the P60 Domain from M. avium subspecies paratuberculosis antigen MAP1204 [Mycobacterium avium subsp. paratuberculosis],3I86_B Crystal structure of the P60 Domain from M. avium subspecies paratuberculosis antigen MAP1204 [Mycobacterium avium subsp. paratuberculosis]
3NE0_A	3.23e-16	206	314	89	201	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q736M3	8.64e-20	198	317	207	321	Gamma-D-glutamyl-L-lysine dipeptidyl-peptidase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) OX=222523 GN=ykfC PE=1 SV=1
Q01837	1.35e-18	206	312	413	509	Probable endopeptidase p60 OS=Listeria ivanovii OX=1638 GN=iap PE=3 SV=1
O64046	4.05e-18	41	182	1408	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.05e-18	41	182	1408	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P21171	7.32e-18	206	312	373	469	Probable endopeptidase p60 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=iap PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.893666	0.035536	0.008760	0.000295	0.000154	0.061603

TMHMM  Annotations     

start	end
7	29