CAZyme Information: MGYG000001445_01098

Basic Information

• Species: Cedecea davisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cedecea; Cedecea davisae
• CAZyme ID: MGYG000001445_01098
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
332		33342.45	4.3222

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001445	4852695	Isolate	not provided	not provided

• Gene Location: Start: 1149737; End: 1150735 Strand: +

Full Sequence      

MQISSGPGGFSPLLPENHFPGLDGAPPDSQNGGNSITAKLLLNNGGNTLAIPLALNFANA
GASDKPSAINFGASPAGNSGPANNPASTSQSDGSNSADGMMQELQQMLQQFLKELMQLFG
MNTGQNKDDASSSSPASGVGSGSGSSGSGAASGADDAGAGAPAAGPAGASGASADSLPPG
DTSLKTSDPTLQKIVSQFGGQYEKASAETGVPAKLLAALTMQESGGDVNAKSTNPGNGLT
DSGMNQINPDTYRAMQSKYPDKLGSDMNSPANQIMCSALMLKEGKEKFGSYDAALRAYNS
GDNQVNLHNLSSVSLGDPNYVNEVNSHMAKFA

Enzyme Prediction     

No EC number prediction in MGYG000001445_01098.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	5.62e-09	213	329	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	1.38e-07	203	306	9	110	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.70e-07	204	306	3	100	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13400	LT_IagB-like	3.22e-06	210	301	2	91	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13401	Slt70-like	5.05e-04	198	306	6	112	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX94562.1	2.14e-167	1	332	1	332
AJZ90431.1	1.13e-157	1	332	1	341
VEB99389.1	1.99e-156	1	331	1	332
AIR65701.1	2.70e-153	1	332	1	339
AIR61385.1	9.59e-152	1	332	1	341

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001445_01098.