CAZyme Information: MGYG000001445_01392

Basic Information

• Species: Cedecea davisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cedecea; Cedecea davisae
• CAZyme ID: MGYG000001445_01392
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843		96365.46	8.0369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001445	4852695	Isolate	not provided	not provided

• Gene Location: Start: 1482007; End: 1484538 Strand: +

Full Sequence      

MNKSTELAPDYIEALPLSAEQKAALPTSDLQAVHEALDAQHHHYERADDSPLASVEARLE
ASWPGSLGGDQLIRDEEGRTQLQAMPKATRSSMFPDPWRTNPIGRFWDRLRGRETHSKFS
SKEEEASEQKWRTVGTIRRYILLILTLAQTVVATWYMKTILPYQGWALINPTDMGGQDLW
VSFMQLLPYILQSGILILFAILFCWVSAGFWTALMGFLQLLMGKDKYSISASTVGDEPIN
PEHRTALIMPICNEDVDRVFAGLRATWESVKATGQQKHFDVYILSDSYNPDICVAEQKAW
MELIAEVQGEGQIFYRRRRRRVKRKSGNIDDFCRRWGNQYSYMVVLDADSVMSGDCLTNL
VRLMEANPKAGIIQSSPRASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNA
IIRVKPFIEHCALAPLPGEGNFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPN
LLDELKRDRRWCQGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQV
VHALTEPQYFLQPRQLFPVWPQWRPELAIALFASTMVLLFLPKLLSIILIWCKGSKEYGG
FLRVTCSLLLEVLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDSTPWGEAFMRH
GSQLLLGLVWAVGMAWLDLRFLFWLAPIVFSLILSPFVSVISSRATVGLRTKRWKLFLIP
EEYSPPQVLVDTDNYLQLNRSRTLDDGFMHAVFNPSFNALTTAMATARHRKSLVLEIARD
RHVEQALNETPDKLNRDRRLVLLSDPMTMSRLHYRVWANPERYTSWVDSYKKLELNPLAL
SSK

Enzyme Prediction     

No EC number prediction in MGYG000001445_01392.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	247	429	1e-24	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05454	PRK05454	0.0	76	717	1	599	glucans biosynthesis glucosyltransferase MdoH.
COG2943	MdoH	0.0	59	832	1	735	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
cd04191	Glucan_BSP_MdoH	1.92e-153	245	498	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
pfam00535	Glycos_transf_2	6.58e-13	248	427	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	2.21e-12	195	591	9	386	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX94312.1	0.0	1	843	1	843
ATF93289.1	0.0	1	843	1	843
AIR03901.1	0.0	1	843	1	843
VEB98831.1	0.0	1	843	1	843
AJZ88952.1	0.0	1	843	1	843

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3KJD8	0.0	6	831	9	832	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=opgH PE=3 SV=1
Q82SA8	0.0	1	840	1	839	Glucans biosynthesis glucosyltransferase H OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=opgH PE=3 SV=1
Q6D6A7	0.0	1	833	1	847	Glucans biosynthesis glucosyltransferase H OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mdoH PE=3 SV=1
Q4KJM5	0.0	6	832	9	833	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=opgH PE=3 SV=1
Q88D04	0.0	10	831	13	830	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
140	157
195	217
513	535
569	591
604	626
681	703