CAZyme Information: MGYG000001445_01909

Basic Information

• Species: Cedecea davisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cedecea; Cedecea davisae
• CAZyme ID: MGYG000001445_01909
• CAZy Family: GH46
• CAZyme Description: Chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
158	MGYG000001445_1|CGC26	17647.66	4.4412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001445	4852695	Isolate	not provided	not provided

• Gene Location: Start: 2040983; End: 2041459 Strand: +

Full Sequence      

MCPRVYGVALLLGISLSGAAGAEDLLSPAKREIAMQLVSSAENSSLDWRKQYAYIEDIDD
GRGYTAGLIGFTSANGDMLDVVERYTSFAPSNRLAEYLPALRRLAENNDDSHEGLEPDFI
QNWKAAARDEKFRAAQDRISLSPSLRWRTNDEDFVIER

Enzyme Prediction     

EC	3.2.1.132

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH46	26	139	3.1e-41	0.5045045045045045

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01374	Glyco_hydro_46	1.86e-56	36	139	1	102	Glycosyl hydrolase family 46. This family are chitosanase enzymes.
cd00978	chitosanase_GH46	2.77e-55	28	139	1	112	chitosanase belonging to the glycosyl hydrolase 46 family. This family is composed of the chitosanase enzymes which hydrolyzes chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Chitosanases play a role in defense against pathogens such as fungi and are found in microorganisms, fungi, viruses, and plants. Microbial chitosanases can be divided into 3 subclasses based on the specificity of the cleavage positions for partial acetylated chitosan. Subclass I chitosanases such as N174 can split GlcN-GlcN and GlcNAc-GlcN linkages, whereas subclass II chitosanases such as Bacillus sp. no. 7-M can cleave only GlcN-GlcN linkages. Subclass III chitosanases such as MH-K1 chitosanase are the most versatile and can split both GlcN-GlcN and GlcN-GlcNAc linkages.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX97916.1	7.65e-91	1	139	1	139
AIR03180.1	2.27e-63	1	139	2	139
ATF92705.1	7.42e-62	1	139	2	139
AIR62212.1	1.21e-60	7	139	7	139
AJZ89648.1	2.42e-60	1	139	1	139

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ILY_A	1.34e-45	20	151	13	146	Abundantlysecreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E],4ILY_B Abundantly secreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]
1CHK_A	8.96e-41	20	145	3	127	StreptomycesN174 Chitosanase Ph5.5 298k [Streptomyces sp. N174],1CHK_B Streptomyces N174 Chitosanase Ph5.5 298k [Streptomyces sp. N174]
4OLT_A	1.04e-38	20	145	11	138	Chitosanasecomplex structure [Pseudomonas sp. LL2(2010)],4OLT_B Chitosanase complex structure [Pseudomonas sp. LL2(2010)]
4QWP_A	1.64e-37	20	145	11	138	co-crystalstructure of chitosanase OU01 with substrate [Pseudomonas sp. A-01],4QWP_B co-crystal structure of chitosanase OU01 with substrate [Pseudomonas sp. A-01]
7C6C_A	2.53e-28	26	140	3	114	ChainA, Chitosanase [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48846	1.72e-40	13	145	37	168	Chitosanase OS=Nocardioides sp. (strain N106) OX=47919 GN=csn PE=3 SV=1
P33665	6.83e-40	15	145	38	167	Chitosanase OS=Streptomyces sp. (strain N174) OX=69019 GN=csn PE=1 SV=1
O07921	2.86e-27	26	140	38	149	Chitosanase OS=Bacillus subtilis (strain 168) OX=224308 GN=csn PE=1 SV=1
P33673	1.46e-07	1	107	24	148	Chitosanase OS=Niallia circulans OX=1397 GN=csn PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000659	0.998477	0.000237	0.000216	0.000188	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001445_01909.