CAZyme Information: MGYG000001446_00129

Basic Information

• Species: Cutibacterium avidum
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Cutibacterium; Cutibacterium avidum
• CAZyme ID: MGYG000001446_00129
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1102		120035.88	7.0866

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001446	2726478	Isolate	not provided	not provided

• Gene Location: Start: 141534; End: 144842 Strand: -

Full Sequence      

MKRLLIAGLAVIVGLGGIVGCGLTAQADDSVAPVGDRVLASAQPRNAGHRLQDIRTWSPQ
TDPYASYLRAQVPLQSRIARDPGTQIRRNLDGKAEVMLMQGDYGNSFFGNFRNNDGFANN
VLNFWQYVDYWSPWHGSATARTPEALYDPATSDWRIRNFEFGIVDIPNAAYTNAAHRNGV
KSIGTIYFDPAFRPGLTFAEAFDKDPNSEGYIIAEKLVEMARYFGFDGYFLNEEEGNLRD
PRFKPFMSYLTSKGLYTQWYTNSSGSFSTSKSNLLDHGKIMDSVFLNYTWPGSQDQSVVA
ARASGYDPHKSLFFGVEANQARFDGKHPSASRLPNLYKSVEDHSPKASVALFTPSDMYQR
GLADDVKPKNVSKSIPLFQQDSYQWMVSERERMYFSGVASNPQDTGSHPGHSRPEVGVKD
SSSWVGVADFTPARSVISGSRFHTDFNTGHGMQWYHDGEVSNSRSWTNMDAQSILPSWQW
WIDTKGSRPSVDFDYGPTEQRRSVDGVSMKTPYQQIGGWRGGSSLVIHGDMSRQTTLKLF
KTRLAVGGNTTMPLTFRKSSASGGAMKVALVFADHPGQVINLAVPQSAARGQWTTSTLDL
GRFAGRTITTIGLQFDPSSHYQMNIGSISVRDGAKAPEAPSRVKLDKVYDDGQAVLSWQT
APFEDVSEYVVDATGSDGKTVHLTSGYTDLAYVKKVPDARGRVTFAVRAVGHDGQVSKPT
TAVFDYSTQPRRIKVAESPTASKLLTEAATPGNLDVSWDPKGLAGTCRIHVSLVDIAPGE
IDNQPYGLTVPCSTGSATVPVPVREGYPYDLTISSDKDQGLSYRGRTHDSWAAPVTLNDI
VIDEDHSGFHMRNLTSPDWYQLDVAWQGMDGTSSLITKIRRGGSVRGGWGASPTTDDPTA
FHRFPAADGTLVTTVTDYAGNTTVQRFMIKGYGLVIPTIKPSFTVRGKDPQKVTAGHEID
PVTMTVSAAAPLSWRTRGSLPDGLLWRSDMSGDGLTPLSGTLSGSPTATGTQRIVVEATD
VYGNSASEEVVVETVAAPSTSSTAPKPTGASGETSNTPIVTAPRIPDTNTTGMGRSPVVT
SHSQWHETMRKERPSMMPHTGF

Enzyme Prediction     

No EC number prediction in MGYG000001446_00129.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	99	455	2.9e-74	0.9968253968253968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	2.10e-68	57	632	42	551	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
pfam03644	Glyco_hydro_85	1.39e-63	115	451	3	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
cd06547	GH85_ENGase	2.41e-51	98	486	1	339	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCQ05451.1	0.0	1	1102	1	1102
AOG29041.1	0.0	1	1102	1	1102
BCQ03039.1	0.0	1	1102	1	1102
AOH46311.1	0.0	1	1101	1	1099
BCY24740.1	0.0	9	1101	2	1092

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W91_A	7.23e-46	52	726	18	634	Structureof a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D. [Streptococcus pneumoniae TIGR4],2W92_A Structure of a Streptococcus pneumoniae family 85 glycoside hydrolase, Endo-D, in complex with NAG-thiazoline. [Streptococcus pneumoniae TIGR4]
3GDB_A	5.27e-45	52	752	169	805	Crystalstructure of Spr0440 glycoside hydrolase domain, Endo-D from Streptococcus pneumoniae R6 [Streptococcus pneumoniae R6]
2VTF_A	1.88e-42	52	685	19	581	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
3FHA_A	1.83e-41	52	685	14	576	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	1.83e-41	52	685	14	576	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1L251	3.84e-12	138	557	122	478	Cytosolic endo-beta-N-acetylglucosaminidase OS=Danio rerio OX=7955 GN=engase PE=2 SV=1
F4JZC2	5.75e-11	153	574	94	455	Cytosolic endo-beta-N-acetylglucosaminidase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGASE1 PE=1 SV=1
Q9SRL4	1.76e-10	159	640	109	570	Cytosolic endo-beta-N-acetylglucosaminidase 2 OS=Arabidopsis thaliana OX=3702 GN=ENGASE2 PE=1 SV=1
P0C7A1	6.28e-09	136	504	141	472	Cytosolic endo-beta-N-acetylglucosaminidase OS=Gallus gallus OX=9031 GN=ENGASE PE=1 SV=1
Q8NFI3	7.41e-08	138	359	144	368	Cytosolic endo-beta-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=ENGASE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000365	0.236538	0.762619	0.000216	0.000149	0.000106

TMHMM  Annotations     

start	end
5	27