CAZyme Information: MGYG000001447_00676

Basic Information

• Species: Prevotella oralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oralis
• CAZyme ID: MGYG000001447_00676
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695	MGYG000001447_1|CGC11	78702.44	7.4227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001447	2849145	Isolate	not provided	not provided

• Gene Location: Start: 788141; End: 790228 Strand: -

Full Sequence      

MQFNGQRKGNNRMSKFRLSIILMVLSLFGGSTISVSAQTAEIKVVEGPDRHARSANYINS
RAPLQQVAFMKLPVGSIRPAGWLGRYLELQRDGLTGHLGEISAWLDKNNNAWLTNGGDHG
WEEVPYWLKGYSCLAYILGDKKMIAETKTWIEAVFKSQRADGSFGPVNLSNGKPELWAQM
IMLTTLQSYYEYTADRRVLDLMTKYFKWELSLPDDHFLEDYWEKSRGGDNLYTVLWLYNR
TGDTFLLDLARKIHRNTADWCQASTFPNWHNVNIAECFREPATYYMLTGEKVFLDASYNN
QQLIRRTFGQVPGGMFGADENARMGYIDPRQGVETCGMVEQMASDEIMLRFTGDTYWADN
CEDVAFNTYPAAVMPDFKALRYITSPNMVQSDSKNHHPGIDNSGPFLSMNPFSSRCCQHN
HSQGWPYYSENLIYATPDNGVAVALYAACEAEVKVEGNKKVTITETTDYPFSDKICFTIS
KGGGRFPIYLRIPSWTNNAEVSINGVKQNAEPVSGKYIRMVYNWKKGDVITLHVPMTLHI
RRWQVNKNSASIDYGPLTLSLKIKERYVQRSSTETAIGDSKWQKNADASQWPAWEIYADS
PWNYALLVAPNSSLGIFEILKNPMPTDNFPFSLENVPLEFRAKGRRIPSWKIDETGLCGV
LPAEDAVKSDTLETITLVPMGAARLRISAFPVVKK

Enzyme Prediction     

No EC number prediction in MGYG000001447_00676.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	198	559	3.4e-33	0.6978131212723658

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.37e-124	109	560	50	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	9.95e-25	120	561	57	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ38172.1	5.90e-166	31	691	14	665
ADO72059.1	1.31e-165	35	691	13	650
BCL79118.1	1.33e-165	57	693	39	664
AEN08321.1	2.27e-165	52	691	39	664
QYA92533.1	1.31e-164	31	691	14	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.01e-14	334	562	333	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	7.16e-14	331	560	334	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	5.58e-13	334	562	333	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001224	0.995943	0.002031	0.000318	0.000241	0.000208

TMHMM  Annotations     

start	end
20	42