CAZyme Information: MGYG000001447_01435

Basic Information

• Species: Prevotella oralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oralis
• CAZyme ID: MGYG000001447_01435
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	MGYG000001447_2|CGC5	52399.05	7.6032

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001447	2849145	Isolate	not provided	not provided

• Gene Location: Start: 389340; End: 390725 Strand: +

Full Sequence      

MKRTTLLFSLIFCITCSVYAQVIKPIKTDVPARPAGQTDVIQLTSPKMNVVRVGFVGLGM
RGPGAVDRWCHIPGTEIKALCDVEADRVEQAQKILERNGRKRATAYSGSTEAYKKMCERK
DIDIIYIITDWVHHVPIALYAMNHGKHVAIEVPAATNMHDIWALINTSERTRKHCIMLEN
CVYDFFELAALNMAQQGLFGEVLHVEGSYLHNLDDYWDMYWDNWRLDFNRKNRGDVYPTH
GIGPDCQVLNIHRGDRMKYLVAMDTKAVNGPKHVQKSTGKPCNDFQNGDQTSTMIRTENG
KTMLIQHNVMTPRPYSRMYQIVGTDGYASKYPIEELCFRTEQLNSSGTANYQDLNAHAAV
PEKVRNELLNKYTPPFVKELEATAKQVGGHGGMDYIMDYRLVYCLRNGLPLDMDVYDMAE
WCCLGELTRISLENNSAPVAIPDFTRGAWNRVKGFSYQFAK

Enzyme Prediction     

No EC number prediction in MGYG000001447_01435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	47	450	1.1e-160	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.68e-11	48	350	1	279	Predicted dehydrogenase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP91144.1	5.17e-250	11	461	14	464
QCQ40599.1	5.17e-250	11	461	14	464
AKA50944.1	5.17e-250	11	461	14	464
CBW21482.1	5.17e-250	11	461	14	464
ANQ59582.1	5.17e-250	11	461	14	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.12e-86	33	449	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	9.33e-65	51	453	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E18_A	5.95e-09	47	326	5	246	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
5A02_A	1.66e-06	109	277	61	214	Crystalstructure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A02_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glycerol [Caulobacter vibrioides CB15],5A03_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A03_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with xylose [Caulobacter vibrioides CB15],5A04_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A04_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with glucose [Caulobacter vibrioides CB15],5A05_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A05_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with maltotriose [Caulobacter vibrioides CB15],5A06_A Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_B Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_C Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_D Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_E Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15],5A06_F Crystal structure of aldose-aldose oxidoreductase from Caulobacter crescentus complexed with sorbitol [Caulobacter vibrioides CB15]
3E82_A	9.83e-06	118	209	64	155	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C863	1.03e-250	11	461	14	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q5LGZ0	1.03e-250	11	461	14	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
Q89ZX8	2.33e-250	14	461	15	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	4.84e-232	25	461	35	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q7MWF4	3.36e-229	25	461	32	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000400	0.998882	0.000238	0.000172	0.000144	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001447_01435.