CAZyme Information: MGYG000001447_01530

Basic Information

• Species: Prevotella oralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oralis
• CAZyme ID: MGYG000001447_01530
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000001447_2|CGC8	39591.1	9.7357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001447	2849145	Isolate	not provided	not provided

• Gene Location: Start: 514881; End: 515936 Strand: -

Full Sequence      

MKTEHILIIRFSAIGDVAMTVPVVYSLATQYPNIRITVLSKPFAKAFFEDLASNVSFMEA
DIKKEYSNIKGLNALYRRLVAKNFTAIADFHSILRSHYLRIRFNIDCYKVAHIDKHRAGK
RRLISNNNKVLIQQPTSFQNYADVLAKLGYPVNLDFTSLFIDKYGRTTVQLPEAIGTKNS
LQQWIGIAPFAAHKGKIYPTESMEKVIQIVVNRHPSCRIFLFGGGEKEKKAFDKWTARYP
ECTNASAISNGLHDELVIMKYLDVMVSMDSANMHLASLVAVPVVSVWGATHPFAGFMGWH
QSIENAVQLDMSCRPCSIYGNKPCMRGDYACMNNITPETIANKIDKILLKK

Enzyme Prediction     

No EC number prediction in MGYG000001447_01530.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	74	328	1.8e-28	0.9644444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	4.53e-45	5	346	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	4.46e-32	5	351	3	333	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	3.79e-07	74	316	3	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85074.1	3.00e-174	1	351	1	350
QNT67212.1	1.27e-173	1	351	1	361
VEH14583.1	8.18e-171	4	347	2	344
ALO49713.1	1.85e-161	1	351	1	350
AGB28723.1	8.36e-161	1	348	17	363

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29