CAZyme Information: MGYG000001447_01608

Basic Information

• Species: Prevotella oralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oralis
• CAZyme ID: MGYG000001447_01608
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	MGYG000001447_2|CGC10	44825.93	8.8562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001447	2849145	Isolate	not provided	not provided

• Gene Location: Start: 607964; End: 609154 Strand: -

Full Sequence      

MKKLFMFLAGAAFSSVAFAQQALWEYPNVQSPIINSDGTVTFNYFDPDAKTVEVRGDFAE
IHQENLAMTKNEKGVWSVTTPHRLAPELYSYAFITDGIRRLDPANAYLNRDVSTYTNIFI
VSHSKDDKGDLYRPNAVPHGNVAKVWYDSPTLKMQRRMTIYTPADYGKGKNYPVLYLLHG
MGGDENAWSELGRAAQIMDNLIAAGKAKPMIVVMPNGNSNCEAAPGAWSAGMYTPSGTAV
KTAPKATLEESFMDIVNFIDAHYKTIRKREGRAVCGLSMGGGHTFGISRMYPTMFDYYGL
FSAAVRVGKEYSRDSFYKDAIASTRFAGEMDKLFASSPKLYWIAIGNEDFLYKNNTELRR
YLDEKGYKYEYFENDGGHLWRNWRIYLTMFAQRLFK

Enzyme Prediction     

No EC number prediction in MGYG000001447_01608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	149	388	2.5e-54	0.9515418502202643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11294	E_set_Esterase_like_N	5.63e-37	38	122	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG2382	Fes	6.73e-31	80	396	14	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.62e-21	149	384	1	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	2.75e-11	163	384	45	298	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	2.15e-09	133	304	2	171	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH16113.1	5.54e-179	5	396	12	413
QNT67052.1	8.66e-159	1	396	1	408
ALJ59664.1	1.01e-141	1	396	1	393
QJE29438.1	1.08e-139	1	396	1	397
QKH98968.1	1.53e-139	1	396	1	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	1.31e-94	31	396	24	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	1.68e-47	27	396	35	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6NE9_A	9.62e-42	27	396	37	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
6RZO_A	6.21e-40	27	396	12	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	6.35e-40	27	396	12	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	6.28e-38	34	396	43	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	3.94e-37	27	396	324	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	2.56e-31	27	396	390	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	4.81e-29	135	392	44	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P9WM38	2.38e-08	141	304	170	314	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000300	0.999005	0.000188	0.000167	0.000165	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001447_01608.