CAZyme Information: MGYG000001447_01914

Basic Information

• Species: Prevotella oralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oralis
• CAZyme ID: MGYG000001447_01914
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
730	MGYG000001447_3|CGC3	84120.37	8.9115

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001447	2849145	Isolate	not provided	not provided

• Gene Location: Start: 95892; End: 98084 Strand: +

Full Sequence      

MKRYKIITWVLLTILFPFTTVAQDSDLITIQGLAKRLIPQQSAQFQFIKLPAHKGKDCFT
LASKGGKIVISGNNANSMAVGLNYYLNNYCRTTVSWYAEVPVVLPAKLPDIKSPVSSSAK
VARRFFFNYCTYGYTVPFFNWKEWERLIDWMALNGINMPLAITGQETVWYNVWKKLGMTD
SEIRSYFTGPTYLPWHRMANIDRWNGPLPKEWLNGQKELQKKILARERAFNMKPVLPAFA
GHVPAELKRIFPDANIKSLGKWGGFEEKYLCHFLSPEEPLFSKIQKLYLEEQTALFGTDH
IYGVDPFNEVEPPSWEPAYLRKVSKNMYGTLTAVDPKAEWMQMGWMFSYDNKHWTPDRVQ
AFLTGVPKGKMSLLDYYCENVELWKTTDGFYGQPYIWCYLGNFGGNTTLMGNVKESGRRL
DNALANGQRNMLGAGSTLEGLDVIQFPYEYLYNKLWSHAVADSRWIDDLADRHYGGVSPS
VRKAWHILFNDIYVQVSASMQGVLTNFRPALNNNYPHRTAIEYPAERLEEVWRLLLDVPR
CDRNELQLDIIAVGRQVLGNRFAVVKTQFDSAYANKDIPRLKAKACEMEELLGDLDRLTS
FNSRCSINRWIDDARKLGSTKELKDYYEKNARNLITTWGGNINDYASRTWGGLIGSYYAH
RWRLYIDDILAAAEANKEFDQNAFNEKVSKFEQAWIISTEPITVPKRTDLLTFCRILIQK
YGLNSAMNRE

Enzyme Prediction     

No EC number prediction in MGYG000001447_01914.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	65	719	1.9e-232	0.995475113122172

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	124	458	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	9.12e-82	465	701	1	244	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	1.90e-27	30	109	3	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77134.1	0.0	5	721	4	719
AHF12614.1	0.0	22	721	21	718
QDH53244.1	0.0	1	721	1	722
QGT72320.1	0.0	1	721	1	722
QUT31320.1	0.0	1	721	1	722

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	9.93e-143	30	721	9	711	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	5.80e-81	22	648	166	803	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	6.57e-81	22	648	174	811	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	5.71e-80	22	648	189	826	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	4.81e-143	30	721	32	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	1.30e-122	15	721	38	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.998998	0.000188	0.000165	0.000164	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001447_01914.