CAZyme Information: MGYG000001447_02329

Basic Information

• Species: Prevotella oralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oralis
• CAZyme ID: MGYG000001447_02329
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
776		85028.58	7.7216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001447	2849145	Isolate	not provided	not provided

• Gene Location: Start: 92915; End: 95245 Strand: +

Full Sequence      

MSKKLNLIIFLCCAMNITAKNILPYKNPALSVEVRVNDLIKRMTLEEKVGQLLCTLAWDY
YYIDGKAVKVSQKFKKELQEKQMGMLWATFRADPWTKKTLANGLNPELAAKAGNALQRYV
IENTRLGIPLFLAEEAPHGHMAIGATVFPTGLGMAATWSTDVIEQAGVIIAKEIRLQGGH
ISYGPVLDLAREPRWSRVEETMGEDPVLSGTIAVAQVKGLGAGDITKPFATIATLKHFIA
YGIPESGQNGAPSIIGTRDLLDNFLPPFRRAIDAGALSVMTSYNSMDGIPCTSNGHLLTE
ILRNQWGFKGFVVSDLYSIDGIYGTHHTVSSLQEAGIEALRAGVDVDLGANAFALLCDAV
RQGRVSEAAIDEAVLRILRMKIEMGLFEHPYVNPKTAKTGVRTAENIQVAKRVAEESITL
LKNSNKLLPLSKNIKIAVIGPNADNRYNMLGDYTAPQQDSNVKTILDGIRSKLSPSQITY
VKGCSIRDTVFNEIGEAVRAAREADVIVVAVGGSSARDFKTSYQETGAAITSSKVVSDME
SGEGFDRASLSLMGIQSRLLQSLKETGKPMVVIYIEGRPLDKTWASEQADALLTAYYPGQ
EGGNAIANVLFGDYNPAGRLPITVPRSVGQLPVYYNKKRPVVHNYVEMASTPLYPFGYGL
SYTSFDYSHLNITKKSEEEYEVSFDIRNSGERDGDEVAQLYISDKVASVVQPVKQLKGFA
RIHLKKGETKRITLILKKDDLSITDRNMERVVEAGDFEIQIGSSSEDIRLKAKLTI

Enzyme Prediction     

No EC number prediction in MGYG000001447_02329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	122	348	7.3e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	27	769	26	758	beta-glucosidase BglX.
PLN03080	PLN03080	1.51e-95	125	762	78	769	Probable beta-xylosidase; Provisional
COG1472	BglX	9.08e-92	43	455	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.41e-74	44	380	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.91e-69	418	662	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48411.1	0.0	18	776	28	786
ALJ42805.1	0.0	1	776	34	812
BCA49360.1	0.0	15	776	1	766
QUT42722.1	0.0	1	776	34	812
QUT70356.1	0.0	1	776	34	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	4.05e-148	25	769	7	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	3.16e-147	25	769	7	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.58e-142	25	769	36	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	5.22e-137	36	769	13	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	1.11e-134	36	776	14	751	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.17e-135	25	769	24	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	7.68e-134	9	769	15	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	1.94e-133	25	769	24	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	9.72e-124	123	771	60	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	9.07e-98	18	768	24	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000303	0.999060	0.000201	0.000151	0.000138	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001447_02329.