CAZyme Information: MGYG000001447_02373

Basic Information

• Species: Prevotella oralis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oralis
• CAZyme ID: MGYG000001447_02373
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		42901.86	8.7141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001447	2849145	Isolate	not provided	not provided

• Gene Location: Start: 33612; End: 34685 Strand: +

Full Sequence      

MLPKYIYRDYYITASDMLKLKRYLKRTINNIEPCPKFPNKRGVVMCAGGIKYFTDAWVTI
SMLRETGCNLPVELFYKGNELNADCIKELKKKKVICRDLNQFGYTNCTGYSLKVLSIFYC
SFQEIFFLDADNIPLRNPEFLFELPEYKKYNAIFWPDYTYTSKENPIWEIMDVEYRYMRE
QESGQIVINKAKCWKEMNLCLEMNKLSYIFYRLLLGDKDTFRFSWMALNTPFYFMQKPPG
SCGFMNNNKFIGFTMLQYDNKDNPLFLHRNLIKYHATKDNEKKWEIIKSYRTPNSDVKFQ
LSHNGKHYVVDLEGDVLIEKFTDVFDDIEIRCLEHLKFIRNKKFYKEFLFKSFLFNE

Enzyme Prediction     

No EC number prediction in MGYG000001447_02373.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	41	259	3e-56	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11051	Mannosyl_trans3	2.98e-39	40	259	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
cd02537	GT8_Glycogenin	0.008	122	158	90	127	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYD49054.1	4.55e-110	31	354	42	372
SNV38160.1	2.31e-101	9	357	13	365
QDW24358.1	2.06e-96	6	347	9	355
QEC72179.1	9.13e-92	30	349	34	356
CDS91369.1	1.17e-91	9	348	12	352

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59KJ7	2.07e-17	4	259	207	526	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
Q59WF4	6.25e-17	26	259	168	461	Alpha-1,2-mannosyltransferase MNN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN2 PE=1 SV=2
Q5A687	2.69e-16	8	293	123	473	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1
Q5AD72	2.33e-15	11	259	250	558	Alpha-1,2-mannosyltransferase MNN24 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN24 PE=3 SV=1
Q5AP90	1.68e-13	41	257	174	447	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001447_02373.