CAZyme Information: MGYG000001448_00451

Basic Information

• Species: Dermabacter hominis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Dermabacteraceae; Dermabacter; Dermabacter hominis
• CAZyme ID: MGYG000001448_00451
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745	MGYG000001448_1|CGC6	81427.98	4.9305

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001448	2361290	Isolate	not provided	not provided

• Gene Location: Start: 464143; End: 466380 Strand: -

Full Sequence      

METVPRSHVKEVMLQDASSLHFAFVSHGSGTLLVRESKNSRLEISIRNSRLVVDISRDGA
RRTLDAEDADHVDDGEMHTLSLTRSANGTNLYLDGYQVFCSTSTLAWPESSEGETLINQL
GDPRIEGMLDLPRELEAREILAKAIAVQPFVEFAASRLSNRDAKRVGKLSKGSIRVRFRV
RGRHQAGTILEARGSNGKLALSIERGNIVYRVIEAEETLCELEAYGQWDDGNWHELVVTT
GYGASTLYVDGYEVARSAGVCFFSDVDGVDRISVGQDLDGARLFGEAQTAMIYARILSDN
HIKHLCGIEPLHTKALFDLGYEDAQSYRIPALLTTHRGTLIAGADQRISIPNDSPNHINF
VIRRSTDGGRTWGPLRTIVRSIGAGLKGASATDPVLVQHRESGRIIALFDHFPGAIGQLN
AIAGTGYTPEGKRILLDSEGEQYVAGSDGTVRSASGSPTDFMLDSDGCLRDGAAQLGHVE
TARDELTAPPLTVMPTSYLWMVVSDDDGETWSEPIDLNPQVKEPWMPFLGASPGTGVCVE
NGPYSGRLVMPVYYSDTSGSSFACAALLSDDAGHTWRLGGSPNDSREWRGCDEASLYESS
IVEVEGGELVVFARNQHPSGNVAVSRSTDGGETWSSVSYDPQLTEIFSQPNAVRIDMDGR
EAVVFANASALLPFRGCGTLRLSMDGARTWPHNRVFNPRHYVYQSMTQLPNGNIGLLWER
EWHGLFFTEIPLTWLTGSQSTRVEA

Enzyme Prediction     

No EC number prediction in MGYG000001448_00451.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	315	721	5.7e-92	0.9327485380116959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	3.89e-95	316	731	3	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	1.56e-20	496	716	79	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	1.04e-17	291	719	240	700	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd00110	LamG	8.11e-04	168	275	18	124	Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans. Proteins that contain LamG domains serve a variety of purposes including signal transduction via cell-surface steroid receptors, adhesion, migration and differentiation through mediation of cell adhesion molecules.
pfam02210	Laminin_G_2	0.001	29	98	7	76	Laminin G domain. This family includes the Thrombospondin N-terminal-like domain, a Laminin G subfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATH95834.1	0.0	1	745	1	745
ANP28539.1	0.0	1	745	1	745
QAU52491.1	1.74e-245	19	741	33	764
AZA13443.1	1.31e-244	19	741	31	762
AZA09383.1	3.21e-243	5	741	6	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TSP_A	4.82e-74	316	719	13	430	Crystalstructure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124],5TSP_B Crystal structure of the catalytic domain of Clostridium perfringens neuraminidase (NanI) in complex with a CHES [Clostridium perfringens ATCC 13124]
2BF6_A	2.56e-73	316	719	12	429	AtomicResolution Structure of the bacterial sialidase NanI from Clostridium perfringens in complex with alpha-Sialic Acid (Neu5Ac). [Clostridium perfringens]
2VK5_A	2.78e-73	316	719	12	429	TheStructure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK6_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_A The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens],2VK7_B The Structure Of Clostridium Perfringens Nani Sialidase And Its Catalytic Intermediates [Clostridium perfringens]
2W20_A	2.44e-64	322	719	21	448	Structureof the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6],2W20_B Structure of the catalytic domain of the native NanA sialidase from Streptococcus pneumoniae [Streptococcus pneumoniae R6]
3H72_A	2.82e-64	322	719	25	452	Crystalstructure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H72_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with NANA [Streptococcus pneumoniae R6],3H73_A Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6],3H73_B Crystal structure of Streptococcus pneumoniae D39 neuraminidase A precursor (NanA) in complex with DANA [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29767	6.94e-73	246	745	295	836	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1
P62576	4.56e-60	322	719	341	768	Sialidase A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=nanA PE=1 SV=1
P62575	4.56e-60	322	719	341	768	Sialidase A OS=Streptococcus pneumoniae OX=1313 GN=nanA PE=1 SV=1
Q27701	7.35e-39	166	720	137	730	Anhydrosialidase OS=Macrobdella decora OX=6405 PE=1 SV=1
Q02834	9.98e-31	307	737	46	403	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001448_00451.