CAZyme Information: MGYG000001448_00740

Basic Information

• Species: Dermabacter hominis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Dermabacteraceae; Dermabacter; Dermabacter hominis
• CAZyme ID: MGYG000001448_00740
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	MGYG000001448_1|CGC11	31359.22	4.6117

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001448	2361290	Isolate	not provided	not provided

• Gene Location: Start: 828609; End: 829460 Strand: +

Full Sequence      

MWSGDYAGAMIHTRMDFHSPALGMGTSAVVLYPQQTDGQIGMAGGIDLDDNGEPHVRVLY
LLHGLSDDCTGWTRRTSIERYASAKGICVVMPEVRRSFYADEVLGEKYWTYVSEELPALI
NQTFRVSTAREDTFVAGLSMGGFGAMKLALNQPERFAAAGSFSGALAVAQRDYTEFGHAM
PARVWGQGLTPEAGSVYEPFFEGVEQGKFPAIDDVNALARAAEPGSLPRLWIGCGTEDFL
LEETRTFVRTLEERGHAHEVTYTPGAHEWAVWDEYVRRFLDWI

Enzyme Prediction     

No EC number prediction in MGYG000001448_00740.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	20	282	5.8e-50	0.9691629955947136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.08e-38	58	283	56	308	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	5.67e-20	47	272	17	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
PLN02442	PLN02442	1.10e-09	14	163	20	175	S-formylglutathione hydrolase
COG2382	Fes	7.39e-07	106	272	152	284	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PRK10439	PRK10439	1.36e-05	108	164	265	321	enterobactin/ferric enterobactin esterase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS34250.1	1.29e-20	58	276	139	335
AMY11314.1	6.18e-19	49	279	166	374
QGW23368.1	8.03e-16	59	272	140	371
AVZ38351.1	8.03e-16	59	272	140	371
QDT36837.1	2.06e-15	50	280	169	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	1.73e-69	14	283	6	261	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	2.44e-38	10	283	9	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
4ROT_A	4.09e-38	6	283	4	257	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
6VH9_A	8.20e-38	12	283	5	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
2UZ0_A	1.75e-34	14	280	9	249	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.09e-24	50	283	35	261	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
Q49575	1.46e-10	51	272	71	307	Diacylglycerol acyltransferase/mycolyltransferase Ag85B OS=Mycobacterium intracellulare (strain ATCC 13950 / DSM 43223 / JCM 6384 / NCTC 13025 / 3600) OX=487521 GN=fbpB PE=3 SV=2
Q06947	3.59e-10	51	272	71	307	Diacylglycerol acyltransferase/mycolyltransferase Ag85B OS=Mycobacterium avium OX=1764 GN=fbpB PE=3 SV=1
Q05861	8.80e-10	51	274	70	311	Diacylglycerol acyltransferase/mycolyltransferase Ag85A OS=Mycobacterium leprae (strain TN) OX=272631 GN=fbpA PE=3 SV=3
D5EXZ4	1.09e-09	47	280	456	665	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001448_00740.