CAZyme Information: MGYG000001449_00037

Basic Information

• Species: Nosocomiicoccus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Staphylococcales; Salinicoccaceae; Nosocomiicoccus; Nosocomiicoccus massiliensis
• CAZyme ID: MGYG000001449_00037
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	MGYG000001449_5|CGC1	40323.79	9.4981

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001449	1509734	Isolate	not provided	not provided

• Gene Location: Start: 14016; End: 15086 Strand: -

Full Sequence      

MKLKDDVVVLTGGGTIGHVMLNTLIAPELLNENVKPYYIGSKTGIEKEIIEKSGIEYYSI
SSGKLRRYLSFENIKDVFKVTKGIFDARRILKKLKPKFVFSKGGFVSVPVVLAAKSLKIP
VYIHESDISPGLANKIAGKFAKKIFVTFEKTLNYVDSSKSEYVGPVIREELLHGSKEIAK
NITGLDPNKPTIMFIGGSLGAKSINDLVHNHIDTFVDQYQVIHITGPDNMREDIKHPNYR
QYEFVQHELAHFYKMSDVVISRSGANVIYELLLLKQPMLLIPLPLSQSRGDQIENAEYFK
SKGYAETIEDESITPKRIIDNIRKIENNKLEYIKNMETFTAGMTPKRLTEHLLKEE

Enzyme Prediction     

No EC number prediction in MGYG000001449_00037.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	191	337	3.2e-36	0.9299363057324841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	4.49e-124	8	336	4	331	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
PRK12446	PRK12446	3.28e-110	8	352	4	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
cd03785	GT28_MurG	2.32e-104	8	336	2	331	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	2.20e-92	8	337	3	333	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	4.36e-84	8	336	3	328	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYA47750.1	1.07e-202	1	355	1	355
QYA46249.1	1.07e-202	1	355	1	355
AKG74120.1	1.27e-145	1	356	1	356
SNV68155.1	6.52e-128	11	348	7	346
ASE34187.1	1.31e-127	11	348	7	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	6.39e-26	4	330	8	338	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	5.94e-25	3	303	1	299	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	1.39e-23	13	309	14	306	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6GGZ0	1.67e-124	11	355	7	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=murG PE=3 SV=1
A7X2A2	4.75e-124	11	355	7	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) OX=418127 GN=murG PE=3 SV=1
A5ISU9	4.75e-124	11	355	7	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus aureus (strain JH9) OX=359786 GN=murG PE=3 SV=1
P65481	4.75e-124	11	355	7	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=murG PE=3 SV=1
P65482	4.75e-124	11	355	7	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Staphylococcus aureus (strain N315) OX=158879 GN=murG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001449_00037.