CAZyme Information: MGYG000001450_02528

Basic Information

• Species: Nesterenkonia massiliensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Nesterenkonia; Nesterenkonia massiliensis
• CAZyme ID: MGYG000001450_02528
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
258	MGYG000001450_14|CGC1	27206.8	3.8704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001450	2641047	Isolate	not provided	Europe

• Gene Location: Start: 8714; End: 9490 Strand: -

Full Sequence      

MLIVAVLSAVVVLIILVQPGGQNPDQSGHRTAEQEYPDEPGQALPPRNPEHQDTSAVPPG
EPVAAGSIADMADPDWVLQAAEATGIPERALEAYAGAALRAQETHPDCGIGWNTLAGIGR
VESHHGRYGGSEIGANGVVEPTIIGIALDGSPGVMEIPDTDGGELDGDTEYDRAVGPMQF
IPSTWRLYAQDGNRDGERNPQQYDDAALTAAAYLCQRGGDLRSDEGWVQAVLAYNQSAEY
VNEVAGFAAEYAELTAES

Enzyme Prediction     

No EC number prediction in MGYG000001450_02528.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	111	250	2.5e-21	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2951	MltB	2.59e-31	83	252	105	276	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	3.07e-23	108	244	1	102	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13406	SLT_2	6.48e-07	174	231	155	211	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
cd16894	MltD-like	0.002	173	235	29	87	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	0.004	174	235	35	93	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEE62342.1	1.24e-69	30	254	37	256
ALJ19803.1	9.21e-68	62	254	61	252
AOS61582.1	1.18e-67	37	257	63	293
AOW94284.1	1.31e-67	56	251	42	236
QXV58490.1	1.29e-66	76	256	111	291

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.284315	0.707457	0.006646	0.000560	0.000407	0.000594

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001450_02528.