CAZyme Information: MGYG000001451_00851

Basic Information

• Species: Paenibacillus_A antibioticophila
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A antibioticophila
• CAZyme ID: MGYG000001451_00851
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000001451_1|CGC13	41729.34	4.7935

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001451	5573040	Isolate	not provided	not provided

• Gene Location: Start: 941891; End: 942994 Strand: +

Full Sequence      

MTVSRPETPIQWARKACDSLMDIYAAAGNLPPAHRWHYHQGVFLCGMELLAQTVQDSGRY
MEYIQQYVDNLVDDYGNFYFARDELDAMQAGQLLFRLHEQTGEPKYKAAADKLRCLLLTL
NRTSEGGFWHKDKYPNQMWLDGLYMAGVFSLKYANAYGETGLREVVLFQERLMRKHMKDE
ATGLLYHAWDESRQMPWANPDTGCSPEFWSRAIGWYGLALSQFLDLLPEDDPGREELAKE
LQGFVQALIRYQDGASGLWYQVVNKGDQKDNWLEASGSCLFVYTLAKAVQFGLAGEEAVI
AARRGFEGLTEIVEWDEQGRLLLPDICIGTSAGDYENYVTRPKVKNDLHGVGAFVMACVE
MRSLMTT

Enzyme Prediction     

No EC number prediction in MGYG000001451_00851.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	31	361	6.6e-103	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.06e-127	7	364	6	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	9.32e-118	12	361	1	339	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CQR58111.1	1.35e-218	1	364	1	362
ASA20461.1	4.31e-218	1	365	6	368
AIQ20362.1	1.76e-216	1	364	1	364
AIQ32237.1	1.67e-215	1	364	1	366
QQZ61827.1	4.62e-215	1	364	1	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	3.22e-139	7	364	11	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.31e-138	7	364	1	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	1.97e-76	27	364	14	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3K11_A	1.02e-15	7	367	46	416	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3PMM_A	6.81e-13	122	360	148	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.76e-138	7	364	11	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.33e-29	149	360	5	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.33e-29	149	360	5	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	6.09e-19	36	278	29	261	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001451_00851.