CAZyme Information: MGYG000001451_00985

Basic Information

• Species: Paenibacillus_A antibioticophila
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A antibioticophila
• CAZyme ID: MGYG000001451_00985
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000001451_1|CGC20	32371.93	4.9335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001451	5573040	Isolate	not provided	not provided

• Gene Location: Start: 1105990; End: 1106880 Strand: +

Full Sequence      

MLITVSKQGDEGFGSLQAALDSIPRGHKSEVTIRIKPGVYEEKITVGPEAPPILLLGEDS
QSTILSWSDNAHTLGPDGEPLGTFRSGTLNVFAENFTAENLTIRNTSGPGTGQAVAAFVD
AGRAVFRRVSLLGDQDTLYTGCGKQYYHECYIEGDVDYIFGAATALFDRCHLHNKRSRGY
ITAASTPEGEPFGYVFLDCRITGGEGVSEVYLGRPWRPHAYVAFIRTQMDASIIGEGWHN
WGQPDREQTSRYEEFGSSGPGANPAARAAWSRQLTDKEAAEYRVITVLDGWHPEGY

Enzyme Prediction     

No EC number prediction in MGYG000001451_00985.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	289	5.4e-98	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	4.51e-93	2	289	6	297	pectinesterase
PLN02682	PLN02682	5.40e-91	3	290	71	363	pectinesterase family protein
PLN02432	PLN02432	2.27e-76	1	282	11	280	putative pectinesterase
COG4677	PemB	7.69e-73	1	291	83	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02665	PLN02665	2.40e-68	2	296	69	366	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV32761.1	1.48e-193	1	296	1	296
AIQ73419.1	6.02e-193	1	296	1	296
QQZ59060.1	2.86e-191	1	296	1	296
CQR54721.1	4.06e-191	1	296	1	296
AIQ68023.1	1.03e-188	3	296	1	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	2.91e-41	2	291	34	361	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.45e-39	5	293	8	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	1.84e-37	5	290	7	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	2.69e-37	3	270	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1QJV_A	1.81e-34	5	293	8	339	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	4.08e-71	2	282	6	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	7.67e-70	3	290	85	377	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9FM79	1.05e-55	2	291	81	377	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q9SIJ9	4.04e-55	1	282	49	320	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q8LPF3	1.14e-53	2	292	60	355	Probable pectinesterase 68 OS=Arabidopsis thaliana OX=3702 GN=PME68 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001451_00985.