CAZyme Information: MGYG000001451_01095

Basic Information

• Species: Paenibacillus_A antibioticophila
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A antibioticophila
• CAZyme ID: MGYG000001451_01095
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000001451_1|CGC23	42029.26	4.6932

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001451	5573040	Isolate	not provided	not provided

• Gene Location: Start: 1233485; End: 1234564 Strand: +

Full Sequence      

MREQMERSRVKGFLRAEGTRVVNEAGEEIILTGWGLGNWLLCEGYMWLSQDESFDRPRRI
EAVIRDLTGTEYAEQFWKRFRNQYITREDIRLMAEQGYNSVRIPIGWRVLMEDEPGIFWK
EENFRLIDQCLDWCEEFGIYAFLDLHGAPGGQTGANIDDSVDDLPRLLTDPESWHKGIEL
WKELARRYRDRWIVGGYDLLNEPVRPGLMEGKQEYYLVRKLTEFYDEAIAAIREIDTKHM
LSIEGHHWATNTAVFYKRYDDNMVIHFHRYACMPGKEAYDEYLALSKRLDQPLWLGETGE
NELEWFAAMXXXXXXXXXGDRGERAGMVRCYVSACRGIGDRIQFVALEEDGASQLPLHG

Enzyme Prediction     

No EC number prediction in MGYG000001451_01095.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	71	311	1.1e-83	0.9221789883268483

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.88e-25	80	299	20	237	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	4.34e-22	77	306	70	296	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG2723	BglB	0.001	76	203	57	169	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	0.004	72	143	3	65	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI31985.1	1.81e-177	1	309	1	309
AIQ47223.1	2.78e-169	1	309	1	309
AIQ52770.1	3.20e-168	1	309	1	309
QSF47399.1	9.13e-168	1	309	1	309
ASB42229.1	8.64e-150	3	309	5	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	4.41e-21	76	270	20	200	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.13e-20	76	270	20	200	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6ZB9_A	2.44e-15	31	283	3	274	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
1EQP_A	3.33e-15	30	217	8	202	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
6ZB8_A	5.94e-15	31	283	3	274	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	1.21e-38	13	308	3	283	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
A1CRV0	1.05e-20	10	270	23	270	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2
P23340	1.77e-20	76	270	20	200	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
A3DJ77	1.77e-20	76	270	20	200	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
Q875R9	4.25e-20	13	216	31	242	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001451_01095.