CAZyme Information: MGYG000001451_01751

Basic Information

• Species: Paenibacillus_A antibioticophila
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A antibioticophila
• CAZyme ID: MGYG000001451_01751
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756	MGYG000001451_1|CGC28	81635.14	6.6058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001451	5573040	Isolate	not provided	not provided

• Gene Location: Start: 1866498; End: 1868768 Strand: -

Full Sequence      

MKLKMITILGAVLGSMLISAEIAAAEQPFSDLQSVKWAEDSINYMAKRGTVAGSGNGQFM
PERHVTRAQAVTFLVRELYPQQLQAGGGASGYSDVPTTHPFYREIAIAAKNGLASGLPDG
TFQPDTAMSRAETAAFLTRAYSLAVGKQSASLKDTADHWAAAPIRIMSSNGLIGGYTDGT
YRPDQPVTRAEFSVFLARVIRFEREAAIQAQDWDKLISYMTVSEQVGQMLMPDIRQWKGQ
VTTTVNEGLKRSIHDQDLGGLILFDKNIVDVRQVTTLTHQLQMEAGDIPLFLGIDQEGGV
VKRIPGGTNLPGQMALGAAGDTVLAEAAGRLTGEELRALGLNINFAPVLDINSNPDNPII
GMRSFGSDAELVSQLGAATIKGLRQSGVIAAVKHFPGHGDTSVDSHLGLPVLTHDRERLD
AVELKPFRAAIENGVEMIMTAHIAFPAVDNEQVISLKDGSSVPIPATLSQKVLKGLLREQ
LGYKGVIISDAFTMNAISEHFGEHQAVERAIAAGVDIILMPQEPAAAHQSLVQAVNSGKL
PVETIHDSVKRILELKSKYGLFDRSDSLANKLASLNDVIGSKEHRAVEREIAERAVTVLA
SRDGKHPDQIHQGDRVVIATADKDQAEQLKRQLIQASGSLSLKTEIVVISLGKATEAFQA
MEQADYVILASYQFRNVASQFGWTDVQTIIDKLNKQSKRYALLSLGNPYEMIHLQNVRSG
LAVYGKQEPNTSAGIQVLLGQLEAGGKLPVTAVRRK

Enzyme Prediction     

No EC number prediction in MGYG000001451_01751.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	287	520	1.1e-68	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	6.99e-106	220	625	1	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.13e-97	221	555	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	6.76e-57	259	531	27	290	beta-hexosaminidase; Provisional
PRK15098	PRK15098	7.22e-24	214	607	39	406	beta-glucosidase BglX.
NF033190	inl_like_NEAT_1	5.75e-18	6	201	557	753	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79125.1	0.0	1	750	1	750
QLG40145.1	0.0	1	750	1	751
QZN74270.1	0.0	1	750	1	750
APO45876.1	0.0	1	750	1	750
AZN41244.1	0.0	1	750	1	756

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	1.32e-141	203	750	25	615	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GYJ_A	4.42e-141	187	750	15	619	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3LK6_A	1.32e-140	206	750	2	589	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
6K5J_A	1.73e-96	220	749	11	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	1.93e-77	222	751	9	526	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	7.22e-141	203	750	25	615	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	5.81e-84	220	751	16	595	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q7WUL3	2.46e-49	249	752	51	555	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
Q31G32	6.81e-42	242	533	20	303	Beta-hexosaminidase OS=Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2) OX=317025 GN=nagZ PE=3 SV=1
Q1H075	7.72e-42	242	531	13	293	Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000245	0.999138	0.000174	0.000166	0.000147	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001451_01751.