CAZyme Information: MGYG000001451_02633

Basic Information

• Species: Paenibacillus_A antibioticophila
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A antibioticophila
• CAZyme ID: MGYG000001451_02633
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000001451_1|CGC40	42121.81	6.1771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001451	5573040	Isolate	not provided	not provided

• Gene Location: Start: 2780765; End: 2781868 Strand: -

Full Sequence      

MNWASKTVRSIMERTPKLYENGYDSKWSYDYGVILKGFALMWKMTGESKYFRFIREQMDH
FIGEDGSIKGYRQDEYNIDHINNGKLLFLLYKETGLGKYRKAADLLRGQLASHPRTSEGA
FWHKQVYPYQIWLDGLYMGAPFYLEYLLTFEGGNGLEDVTKQFILCEKHTRDPETGLLYH
AWDEQKVQPWCDPATGLSPNFWGRSMGWFVMALADTLELLPKEHRDYNELVRIFRDALTA
LRNYQDQASGVWYQVINLGGRKGNYLEASASSMIVYALAKGIRIGVLGQEAWRSTVDKAF
EGLITEFVLETKEGWVNLNKNCQVAGLGGSDRRDGTFAYYISEPIITNDFKGVGAFIQAC
AEYEGLQ

Enzyme Prediction     

No EC number prediction in MGYG000001451_02633.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	21	364	1.9e-114	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.28e-120	1	366	9	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	1.50e-104	3	364	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV36896.1	8.57e-217	1	367	1	367
AIQ76451.1	2.01e-215	1	367	1	367
AIQ20379.1	7.72e-215	1	367	11	377
AIQ34932.1	2.98e-214	2	367	5	370
AIQ23081.1	8.52e-214	2	367	5	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.33e-152	27	366	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	9.61e-92	1	366	14	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.99e-91	1	366	4	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	8.72e-14	27	304	66	330	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	5.06e-13	27	304	65	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	5.26e-91	1	366	14	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.11e-40	138	362	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.11e-40	138	362	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001451_02633.