CAZyme Information: MGYG000001452_02659

Basic Information

• Species: Stoquefichus massiliensis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Stoquefichus; Stoquefichus massiliensis
• CAZyme ID: MGYG000001452_02659
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487	MGYG000001452_8|CGC6	56301.79	5.676

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001452	3433076	Isolate	not provided	not provided

• Gene Location: Start: 211163; End: 212626 Strand: +

Full Sequence      

MSFRKDFLWGGATAASQHEGGFNKGGRGLSTFDTVTGGGYQIPRFITYITKDGEYGEAPI
DSTMTGKIPLHAKGYINKDLFYPSHQATDFYHHFKEDIALMAEMGFKCFRMSMSWSRICP
NGMYDINEEGLQFYDDIFDECLKYGIEPVVTLNHFDMPLYLADHYDGWLSREVIDSFVFY
AKTVFTRYKDKVKYWMTFNEINVLSGWCQIGIHDNCPQNLYQAHHHIFIASAKAVMIGHE
INPHNQIGMMVSYTPSYPMTCLPEDVMEAIEFNRQKHFYMDVQVKGYYPDYQLKLFERKN
IHIHMEENDLKIIEKGTVDFIGLSYYMSTVSSTDPNAEKTEGNQFIAYKNPYLKTSDWGW
TVDPLGLRIALNEIYDRYHKPLFIVENGLGAADTMKDDGTIDDDYRIEYLKNHINAMKDA
VELDGVNLMGYTPWGCIDIVSAGTGEMKKRYGFVYVERYDDGTGDFSRRKKKSFDWYKKI
IETNGNI

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	485	1.4e-148	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15014	PRK15014	0.0	1	485	4	474	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	487	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	485	4	474	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	1	485	2	473	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	2	485	3	470	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQV86364.1	3.77e-246	1	485	1	482
AVR93003.1	3.77e-246	1	485	1	482
QZK93302.1	3.77e-246	1	485	1	482
QOG32817.1	5.35e-246	1	485	1	482
QTI52956.1	5.35e-246	1	485	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	1.64e-186	1	485	6	476	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
6WGD_A	2.05e-177	3	485	8	466	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	2.61e-173	5	486	9	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	7.43e-173	5	486	9	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.70e-166	5	486	9	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	8.96e-186	1	485	6	476	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	3.39e-183	5	485	6	476	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	6.90e-173	3	485	8	466	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	3.66e-166	1	485	5	468	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	1.53e-165	3	485	4	470	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001452_02659.