CAZyme Information: MGYG000001453_02880

Basic Information

• Species: Aneurinibacillus aneurinilyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Aneurinibacillales; Aneurinibacillaceae; Aneurinibacillus; Aneurinibacillus aneurinilyticus
• CAZyme ID: MGYG000001453_02880
• CAZy Family: GH18
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1139	MGYG000001453_163|CGC2	129914.56	6.428

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001453	5302959	Isolate	not provided	not provided

• Gene Location: Start: 19480; End: 22899 Strand: +

Full Sequence      

MTNAWIPPISIVEGMLAAGLAYLIFASLYQRKNKHRRISGTKHFIFHDDFGYRWSFLKRF
GILLGVVSLIVLCIFGLSLNSDPSLPKLSFEKNSKLNLIQPIMEKINEHSLIKQLKEEEK
THPTFQLDFKRHHKNKAMQQMTQKEVYGFYVNWDENSKNSLKKNIHFLTTVIPEWYHLNP
DTSLHKDIQFDVQQLAKNNNVKIMPLVSNFANGIWDATLVHNIITSPAKRQEFIEQLYSE
AKKNDYSGFNIDFEAIDKKDQDALTAFMGELYRKFHANGLQLTEDVPAQDDAFDYGALAN
VTDRMIVMLYDEHYQSGKPGPIASISWFENALEQLDIPPEKLIVSLGSYGYDWIENSNQS
ADTVTFGDIMEMAHNSRLNIQWDKRSQNPYMRYKEGEDSHIVWFLDGVSVYNQLKISMEN
GARGVALWRLGSEDPTVWDVLKQPDHFESQTALLHTLTSSEPVHYSGDGEVLQVVSSEKE
GKRYFNVTQDGSLSNESYVSYPVPFQVNRYGKAMGKQVVLTFDDGPDPEYTPKILDILDR
YKIKGSFFIVGENAELNPDIIKRIYQNGHEIGSHTFTHPNVAEISPMRTKMELNANQRLF
QEITGHSMTMFRPPYVADASPSTPEELLPILRAQQMGYTTIGESIDPEDWQKPSSDEIIR
RVLKELPNGNIILLHDAGGDRTNTIEALPKIIETLKSKGYTFTTIHQLLGKKADELMPPV
EYTENPFIIYDQTVFTAFSGWQKGITFMLYLSISVGIIRFLFLVYYASRQKKRYLSLTPN
NSFTPSVSVVIAAYNEEKVICKTIDSILQSDYPDFEVIVVDDGSVDQTSAVIQKTFGQNS
RIKLITKENGGKSSAVNRGFIEASGEIVVALDADTMIAPDAIALLTRHFADPNIAAVSGN
VKVGNIRNLLTTWQQVEYITGFNLERRAFDELNCIAVVPGAIGAWRKEAVAEAGYLKEDT
LAEDTDITLTLLQKGYRIMYEEQAYAYTEAPEDVLSLLKQRYRWTYGTLQCLWKHRRALF
NRKHKSLGFVGLPNMWLFQYIFQTISPIADILFIMGLFGIQPGKTLVFYGLFFLIDFLAS
FYAFRLEGENPKPLLWLFLQRIIYRQFMTYIVIKSIVSALKGITVGWNKLQRLGNVINK

Enzyme Prediction     

No EC number prediction in MGYG000001453_02880.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	143	432	2.8e-38	0.9358108108108109
GT2	785	1007	6e-38	0.9956521739130435
CE4	515	638	3.1e-32	0.8923076923076924

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10962	CE4_GT2-like	2.36e-103	516	710	1	196	Catalytic NodB homology domain of uncharacterized bacterial glycosyl transferase, group 2-like family proteins. This family includes many uncharacterized bacterial proteins containing an N-terminal GH18 (glycosyl hydrolase, family 18) domain, a middle NodB-like homology domain, and a C-terminal GT2-like (glycosyl transferase group 2) domain. Although their biological function is unknown, members in this family contain a middle NodB homology domain that is similar to the catalytic domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Like SpPgdA, this family is a member of the carbohydrate esterase 4 (CE4) superfamily. The presence of three domains suggests that members of this family may be multifunctional.
cd02874	GH18_CFLE_spore_hydrolase	4.20e-80	143	441	1	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
cd06549	GH18_trifunctional	4.36e-79	147	438	3	298	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
cd10917	CE4_NodB_like_6s_7s	1.45e-68	516	696	1	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
cd06423	CESA_like	6.58e-65	789	964	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAU27076.1	0.0	1	1139	1	1139
BBH22793.1	0.0	12	1136	103	1222
AZV44008.1	0.0	10	1136	100	1223
AIE58921.1	0.0	32	1136	3	1112
QUG86973.1	0.0	45	1136	15	1106

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FBW_A	1.68e-44	502	712	101	303	ChainA, Predicted xylanase/chitin deacetylase [Caldanaerobacter subterraneus subsp. tengcongensis MB4]
5O6Y_A	4.15e-38	510	705	18	204	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579]
5O6Y_B	4.90e-37	510	705	18	204	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579],5O6Y_C Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579],5O6Y_D Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579]
2C1G_A	2.14e-36	484	716	209	425	Structureof Streptococcus pneumoniae peptidoglycan deacetylase (SpPgdA) [Streptococcus pneumoniae R6]
4L1G_A	2.46e-36	510	705	70	256	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579],4L1G_B Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579],4L1G_C Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579],4L1G_D Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q81AF4	1.13e-41	493	712	7	212	Peptidoglycan-N-acetylglucosamine deacetylase BC_3618 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=BC_3618 PE=1 SV=1
Q81EK9	1.22e-36	510	705	78	264	Peptidoglycan-N-acetylglucosamine deacetylase BC_1960 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=BC_1960 PE=1 SV=1
Q8DP63	2.06e-35	484	716	241	457	Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pgdA PE=1 SV=1
P50354	1.74e-33	518	705	21	213	Chitooligosaccharide deacetylase OS=Rhizobium galegae OX=399 GN=nodB PE=3 SV=1
Q8GLC5	2.45e-33	747	1136	6	410	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
60	79
744	766
1026	1045
1065	1084