CAZyme Information: MGYG000001456.1_03047

Basic Information

• Species: Eubacterium_I ramulus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eubacterium_I; Eubacterium_I ramulus
• CAZyme ID: MGYG000001456.1_03047
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1351	MGYG000001456.1_120|CGC1	145907.49	4.1224

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001456.1	3435082	Isolate	not provided	not provided

• Gene Location: Start: 35756; End: 39811 Strand: -

Full Sequence      

MKMKKLLTILLAASIVAGSAQVPGLTMQVQAAQVQTQESAGSATATYNGKTFNRASAAYQ
DGDVSYEGMPLYNGNAEDLDDYVNLIMDEIGVDGWISILAGKSPVGTYADENGESKTYNV
PITVNRAADVGLDGETQWPNQLAQAQTWNTDLLKQAGSVYGDEMRSKYATSSIGTTAVGA
HAAQIDARMNPLSGRYDEGYGEDAFMIGEMADAWAGGMVGDESDVYMKSIPQTKHWTTYN
SEFFRLQGGNNVSTRTFYEYYGKAAEKPFSDGTITGYMSSYGNMNRVPTTSTFIHDFAQK
ISKDGVTTGCDFMAEYGYIDEQYRLNASGFSNGYDKLYSSSLLDRTASMILAGHIQGGTT
GIADADIAQTIKTAVENHVEGLTEDDVYKVARPTIVTMARSGALDERDENGQPRYYPYTD
IKTDHSSKTSQETELQMAEESVVLLKNENHTLPLSSDSKAGVYGVMAETMQYGQYSSELD
VNDEKYNTYVQGAGDNIVEAVQSQIGSDNVSYSTGNRVVAYKTAGGYVTATEDENGAQLT
VSNPEEGTKAADQSKYLFEYADWGQDAFSLLSLANQKWINAGVKNNSLPGNTMGLYDAAV
SNNGSYSMKASAGMATAVSNMPTFMSKRAADEDGNYYLKMGDKYNDTDFSTTWALSDKLG
WYLQTTEDGKIKLNGDAQPIQGPNLPFLLGGNLATGIAAFESAEDKTPYTFKEETIKEAG
ADSEELAADTDYAIVVIGQPYNGISGEGVDRKYLSLSEDQMDMVSTVAANYAKAGKKTIV
IINTEYPVEAEALQNDENVSAIVFNAFGGQYDATALVNVLYGEAAPTGRLVSTWYKSKDA
LPAIDEYSVPNNAMALIGPDLVQGMTLDDIDDNVTVDMTETDMEQKHLTYMYADDEDVTY
PFGYGLSYSSFDYSGMSAKANEDGSVDVSVTVKNTGKVDTSDVVEIYASNPDSSYGNAVP
KKKLVGFEKVALKAGESANVDIHVDASALEVWDVNAGEYVVEGGTYQLYAAHSSDLKGEN
VLNKKVKVSGSTLSNADTAEKRNVWSSSFTASDVKYVEYSKGNTAEAAAADSDEIFAVMA
KKSGAYTALLNVDLDQVKQAVLTVASTEAENGIELRLDAPDGKLIGTATYGATEAVTNKR
TADNGVDAGTYTELGYTTASADLSGASGVHNVYLVFKNANARVEGIQFVTSGVTIPDGLA
NEADENGNWNYYIDGKVATDATGLAPNAYGWWYVKNGKVDFTYTGLASNDQGWFMVVNGM
VDFGYTGLVANEYGWWMVQNGSINFAYTGLAANEYGWWYVQNGSINFNYTGLAANEYGWW
YVNGGKIDFGYTGRAANEYGWWNVVNGKVVF

Enzyme Prediction     

No EC number prediction in MGYG000001456.1_03047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	131	290	1e-22	0.6712962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.83e-25	713	1008	489	748	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	9.08e-25	713	843	78	198	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	1.26e-23	680	985	425	743	Probable beta-xylosidase; Provisional
pfam14310	Fn3-like	2.30e-21	942	1014	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.
cd04084	CBM6_xylanase-like	2.47e-16	1077	1188	25	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79412.1	5.71e-171	68	1189	31	1124
AYA77556.1	2.42e-168	66	1188	51	1145
AYQ75660.1	9.32e-164	66	1187	50	1133
QMV43973.1	1.92e-163	66	1188	24	1116
QKS56187.1	3.42e-161	60	1188	45	1144

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.44e-31	138	1005	64	823	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.05e-29	138	1005	64	823	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
5TF0_A	8.63e-28	652	1014	414	740	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
4I3G_A	3.11e-24	747	1023	579	827	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
7MS2_A	7.32e-23	713	1028	391	674	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07337	4.23e-29	138	1005	64	823	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
D5EY15	3.03e-28	127	1015	76	851	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
A2QPK4	3.33e-26	725	1017	470	743	Probable beta-glucosidase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglD PE=3 SV=2
B0XPB8	1.05e-25	690	1014	447	758	Probable beta-glucosidase M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglM PE=3 SV=1
Q4WR62	1.39e-25	690	1014	447	758	Probable beta-glucosidase M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.998830	0.000318	0.000205	0.000180	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001456.1_03047.