CAZyme Information: MGYG000001457_00563

Basic Information

• Species: Pseudomonas_B luteola
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_B; Pseudomonas_B luteola
• CAZyme ID: MGYG000001457_00563
• CAZy Family: GH8
• CAZyme Description: Minor endoglucanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000001457_1|CGC2	35204.54	6.2681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001457	5659210	Isolate	not provided	not provided

• Gene Location: Start: 539668; End: 540621 Strand: -

Full Sequence      

MSCQQGWDIYQQRFVTVQGRVTDTGNQGISHSEGQGYAMLIAEANGDRRAFDRLWSWTKQ
TLQREDRLFSWRYDPKANPAVTDRNNASDGDLLIAWALQQAGERWQNPAYAKASKQIRDA
IAAHLIQRDQGYTLLLPGLEGFKRPDGTVINLSYWIFPALQAFARIEPEGPWTALFQSGT
QLLQAAQFGEAKLPSDWIALGADGTLKPAEGWPSRFGFDAVRVPLYGAWAELGKRGEWRA
VSTFWHSKDPASPPAWVDLASGEVAPYAASWGVLGIRALLDGQPQSLQAEVLKQEDYYSS
SLLMLSQIAQGNCGKAR

Enzyme Prediction     

No EC number prediction in MGYG000001457_00563.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	5	309	3.4e-81	0.990625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	3.57e-75	5	311	6	320	Glycosyl hydrolases family 8.
COG3405	BcsZ	2.15e-57	7	309	29	343	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	1.34e-44	7	307	28	349	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYN94008.1	7.23e-238	1	317	26	342
QEU28409.1	4.18e-237	1	317	26	342
AGK13288.1	1.22e-113	7	310	30	332
AGK17606.1	1.22e-113	7	310	30	332
ACO76759.1	1.22e-113	7	310	30	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CZL_A	1.10e-87	7	312	32	336	ChainA, Glucanase [Raoultella ornithinolytica]
5GY3_A	4.19e-86	7	310	4	306	ChainA, Glucanase [Klebsiella pneumoniae]
6VC5_A	3.27e-77	5	310	6	313	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	7.84e-73	5	310	21	328	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]
4Q2B_A	4.99e-29	7	307	7	324	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27032	3.38e-90	2	311	22	331	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P18336	4.87e-80	4	284	24	304	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1
P37696	3.80e-75	5	310	29	336	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
Q8ZLB7	9.66e-27	7	295	29	320	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8X5L9	1.82e-26	7	295	28	319	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001457_00563.