CAZyme Information: MGYG000001457_00924

Basic Information

• Species: Pseudomonas_B luteola
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_B; Pseudomonas_B luteola
• CAZyme ID: MGYG000001457_00924
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231	MGYG000001457_1|CGC7	26628.64	10.0587

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001457	5659210	Isolate	not provided	not provided

• Gene Location: Start: 897808; End: 898503 Strand: +

Full Sequence      

MVRSLLRRLFRYTLISMAASVLLVLLFRWVPPPGSMVMVERKIESWIDGKPIDLYREWRP
WRELPDNLKMSVVAGEDQHFSEHWGFDMDAIRQAFSHNEAGGSLRGASTISQQVAKNLFL
WTGRSWVRKGLEAWFTVLIETLWPKQRILEVYLNSVEWDSGIFGAEAAAQHHFGIGAPYL
SDRQASLLAAILPNPREWSPSHPSAYVSRRANWIRQQVRQLGGSDYLLHMK

Enzyme Prediction     

No EC number prediction in MGYG000001457_00924.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	55	217	6e-49	0.9209039548022598

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.59e-126	1	227	4	232	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.47e-103	3	223	1	223	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	5.33e-74	1	223	20	245	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.43e-61	48	217	1	175	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.54e-37	47	222	54	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEU28082.1	9.45e-169	1	231	1	231
AYN93686.1	1.91e-168	1	231	1	231
QEU06114.1	3.79e-139	1	230	1	230
QNQ96908.1	1.54e-138	1	230	1	230
ALZ83259.1	1.54e-138	1	230	1	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.70e-27	63	220	27	186	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	3.37e-27	63	220	27	186	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	8.02e-22	48	225	27	209	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	2.26e-20	60	220	160	325	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	2.28e-20	60	220	181	346	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4VRK8	8.82e-125	1	231	1	231	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas stutzeri (strain A1501) OX=379731 GN=mtgA PE=3 SV=1
Q3K584	3.71e-121	1	228	1	228	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=mtgA PE=3 SV=1
Q9I6B7	8.01e-121	1	231	1	231	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=mtgA PE=3 SV=2
Q48CL6	1.31e-120	1	227	1	227	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=mtgA PE=3 SV=1
A4Y001	4.62e-120	1	231	1	231	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
9	31