CAZyme Information: MGYG000001457_02597

Basic Information

• Species: Pseudomonas_B luteola
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_B; Pseudomonas_B luteola
• CAZyme ID: MGYG000001457_02597
• CAZy Family: GT9
• CAZyme Description: ADP-heptose--LPS heptosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		37896.01	6.9973

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001457	5659210	Isolate	not provided	not provided

• Gene Location: Start: 2700566; End: 2701600 Strand: +

Full Sequence      

MRILIIGPSWVGDMVMAQTLFKSLQALHPGCAIDVLAPDWSRPLLERMPEVRSALSFPLG
HGAFELATRRRIGRSLRGQYDQAILLPNSLKSALVPYFAGIPKRTGWRGEMRFGLLNDIR
TLDKARYPLMIERFIALAYPPGAELPKPYPHPQLRIESASRDAALGKFGLELDRPVLALC
PGAEFGESKRWPAAHYAEVANVKIRAGWQVWLFGSQKDNAGCEEIRERLIPGLREEVMNL
AGQTALAEAIDLMSCASAVVSNDSGLMHVAAALDRPLVAVYGSTSPGFTPPLAEEVEVVR
LGIECSPCFDRTCRFGHYNCMRLLEPAAVLRALDQLVADPVEVE

Enzyme Prediction     

EC	2.4.99.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	70	319	2.3e-55	0.9777777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02195	heptsyl_trn_II	0.0	2	336	1	332	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10916	PRK10916	1.78e-162	1	301	1	307	ADP-heptose--LPS heptosyltransferase RfaF.
pfam01075	Glyco_transf_9	4.00e-100	69	318	1	246	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	2.53e-99	1	340	2	333	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	3.44e-81	2	335	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEU30238.1	6.86e-255	1	344	1	344
AYN95741.1	3.26e-253	1	344	1	344
QNQ98308.1	3.37e-214	1	343	1	343
ALZ83455.1	4.78e-214	1	343	1	343
QKF51021.1	2.76e-213	1	343	1	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	4.91e-114	2	337	2	343	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]
2GT1_A	5.13e-09	1	287	1	285	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	5.13e-09	1	287	1	285	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	5.31e-09	1	287	1	285	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
3TOV_A	1.34e-08	189	339	199	347	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37692	3.57e-121	1	337	1	343	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P37421	5.82e-120	1	339	1	345	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P45042	6.24e-114	1	301	1	307	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1
P26469	2.58e-09	1	287	1	285	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
P24173	2.03e-08	1	287	1	285	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001457_02597.