CAZyme Information: MGYG000001458_00385

Basic Information

• Species: Cetobacterium_A somerae
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Cetobacterium_A; Cetobacterium_A somerae
• CAZyme ID: MGYG000001458_00385
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000001458_21|CGC1	40955.33	9.2631

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001458	3064648	Isolate	not provided	not provided

• Gene Location: Start: 41077; End: 42129 Strand: -

Full Sequence      

MKILVVRFKQIGDAILSSVICKSLKETYPDAKVDYVLYDHVAPLFEHQDYLNKVISISKD
EQKNPFKYLKKVWNVTRTDYDIVIDIMSTPKSEAFTLFSRKAKYKIGRWKPKRGYTYTHS
IPEPSSEFDKAEKFLKMLKPLIDDGVDVKLDKNYSLTFLSEEKNDLRKRMKEAGVDFNKI
IIPLAINSRRESKVYPIDLMKELAKKILDEFDCQIILYYSPNEKEFAKKFHEELNWDKRI
ISDINTKSIRELGALLSNCDIFVGNEGGPRHLAQAIDIPSFSIFSPGSSKRDWLSRDNKR
HEGIEPKDVLSDKTYDNLSYEEKYRLITPDIVLEKVREKMELVPKYIEKK

Enzyme Prediction     

No EC number prediction in MGYG000001458_00385.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	77	306	1.4e-31	0.8666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	3.67e-49	2	338	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	7.81e-47	1	336	2	326	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	6.71e-16	79	291	12	216	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.57e-12	2	293	7	299	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH40966.1	3.30e-140	1	338	1	335
AVQ30453.1	3.30e-140	1	338	1	335
ADO84502.1	3.34e-139	1	350	1	337
AVQ30518.1	5.09e-138	1	337	1	334
VEH40894.1	5.09e-138	1	337	1	334

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	1.34e-13	12	284	5	276	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	4.32e-13	12	284	5	276	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P44011	1.10e-12	2	293	3	296	Putative glycosyltransferase HI_0523 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0523 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001458_00385.