CAZyme Information: MGYG000001458_01226

Basic Information

• Species: Cetobacterium_A somerae
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Cetobacterium_A; Cetobacterium_A somerae
• CAZyme ID: MGYG000001458_01226
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		21752.73	4.8931

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001458	3064648	Isolate	not provided	not provided

• Gene Location: Start: 20513; End: 21082 Strand: -

Full Sequence      

MRYRNKLTLLFCLMFSTIFSKDELLETYILKNISNLENAQFIYEDIIRFSSKYEIDPALV
VSIIKVESNFNHNAISEKGAIGLMQLMPETAEELQVDPFNVSSNIEAGIRYFSRCLKLNN
NDIALALASYNAGHSSVQKYESIPPFTETDNYISEVLKIYTGSFNKKYIFNPVSFQESTF
KFGEKDENR

Enzyme Prediction     

No EC number prediction in MGYG000001458_01226.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	167	8.3e-30	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.17e-45	57	160	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	4.07e-42	43	160	4	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.73e-34	44	157	8	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	7.91e-29	46	152	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	1.03e-26	46	139	1	101	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEO42572.1	7.15e-45	4	187	2	189
EFG34987.1	1.01e-44	4	187	2	189
QQB74851.1	1.84e-43	13	187	12	193
ALF24927.1	7.39e-43	13	187	12	193
ATV71382.1	2.09e-42	13	187	12	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FPN_B	1.38e-11	44	157	428	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.38e-11	44	157	432	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O1J_A	1.38e-11	44	157	422	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	1.38e-11	44	157	418	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O29_A	1.39e-11	44	157	438	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	4.84e-27	50	160	68	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	2.31e-24	50	186	1430	1572	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	2.31e-24	50	186	1430	1572	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	7.02e-08	43	133	8	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	3.44e-07	50	143	294	394	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000801	0.998152	0.000450	0.000191	0.000192	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001458_01226.