CAZyme Information: MGYG000001458_01336

Basic Information

• Species: Cetobacterium_A somerae
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Cetobacterium_A; Cetobacterium_A somerae
• CAZyme ID: MGYG000001458_01336
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		41807.63	9.561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001458	3064648	Isolate	not provided	not provided

• Gene Location: Start: 7273; End: 8364 Strand: -

Full Sequence      

MIRKLNRVVQDFLRPIRLSIGRKLWDRKNEKHTELLKDKKVDMSRVKSILFLRYDGKIGD
MVINTLMFREIQKRYPEIKIGVVSRGAATDIIKFNPHVNKIYNYKKGKESELANELAKEN
YDVLVDFSEMLRVNQMKFINLCKAKVNVGLDKSDWKLFDISYKKDYSKHITDMYKNILSL
FGIENPDLSYEIHTGIVVKDEIRRRLRELGNPESFVVLNPYAASKHRSFNKEKILEISCK
ILKESKSMLIFIGEPSKKSEIEEIIEVLGDRDRVKYPTLSGILEVVELIKHADYVITPDT
SIVHIGVAEKLPMTAVYRLDTGDNNSVVWGPNSPLVKQVFSSDVPAVGEEADINKFDVKE
IGV

Enzyme Prediction     

No EC number prediction in MGYG000001458_01336.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	111	332	2.1e-23	0.8488888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	1.76e-36	46	361	1	317	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.55e-27	48	339	1	240	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	1.57e-09	49	343	10	310	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	2.08e-07	112	339	4	227	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02195	heptsyl_trn_II	4.34e-05	58	334	10	282	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBA50403.1	2.93e-116	1	361	1	364
BBA50393.1	1.67e-115	1	361	1	364
AVQ31329.1	3.90e-115	1	361	1	364
ADO84513.1	4.77e-115	1	359	1	356
SQJ09816.1	9.41e-113	1	361	1	364

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27242	6.01e-11	42	341	36	331	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Escherichia coli (strain K12) OX=83333 GN=waaU PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001458_01336.