CAZyme Information: MGYG000001460_01187

Basic Information

• Species: Romboutsia dakarensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Romboutsia; Romboutsia dakarensis
• CAZyme ID: MGYG000001460_01187
• CAZy Family: GT4
• CAZyme Description: Mannosylfructose-phosphate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
173		19996.12	7.925

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001460	3735762	Isolate	not provided	not provided

• Gene Location: Start: 12; End: 533 Strand: +

Full Sequence      

MGTISPSKNLVRLIKAFKEVNKMNKKLKLVIVGKNGWKFEDVYKTVEEFKLNDSVIFTGY
VSDDELESLYKKAMFVVYPSLYEGFGLPPLEAMSRDKSVLVSDIPVLKEILGDAAFYFNP
YDEEDMVKHILNLTSNKEYRNSKREVASKTVNLYSWEKCAQKTYNVYEKLMGE

Enzyme Prediction     

No EC number prediction in MGYG000001460_01187.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	1	141	5.8e-37	0.88125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	1.64e-71	2	163	199	360	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03801	GT4_PimA-like	1.05e-37	2	168	199	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	7.88e-37	2	173	206	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	3.29e-32	1	141	8	149	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
pfam13692	Glyco_trans_1_4	5.08e-26	8	136	15	138	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH66971.1	4.34e-49	1	171	195	365
BAK55828.1	6.81e-45	1	171	199	366
BAK79188.1	6.81e-45	1	171	199	366
AID43992.1	6.81e-45	1	171	199	366
ADZ85470.1	8.97e-45	1	171	195	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L01_A	1.77e-08	11	167	274	427	ChainA, GlgA glycogen synthase [Pyrococcus abyssi],3L01_B Chain B, GlgA glycogen synthase [Pyrococcus abyssi]
3FRO_A	1.78e-08	11	167	274	427	Crystalstructure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_B Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi],3FRO_C Crystal structure of Pyrococcus abyssi glycogen synthase with open and closed conformations [Pyrococcus abyssi]
2BIS_A	1.79e-08	11	167	275	428	Structureof glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_B Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi],2BIS_C Structure of glycogen synthase from Pyrococcus abyssi [Pyrococcus abyssi]
5I45_A	4.97e-06	40	173	78	215	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26402	1.17e-19	1	133	190	319	Protein RfbU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbU PE=3 SV=1
Q59002	2.90e-15	1	171	214	385	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
Q58577	4.17e-14	1	170	185	349	Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1178 PE=3 SV=1
P26470	1.06e-12	2	162	200	370	Lipopolysaccharide 1,2-N-acetylglucosaminetransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=waaK PE=3 SV=1
Q8CWR6	1.60e-12	1	131	213	342	Alpha-monoglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0982 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001460_01187.