CAZyme Information: MGYG000001460_01255

Basic Information

• Species: Romboutsia dakarensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Romboutsia; Romboutsia dakarensis
• CAZyme ID: MGYG000001460_01255
• CAZy Family: PL8
• CAZyme Description: Xanthan lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847	MGYG000001460_57|CGC1	96988.39	5.4075

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001460	3735762	Isolate	not provided	not provided

• Gene Location: Start: 9924; End: 12467 Strand: +

Full Sequence      

MKKKIELDERKNYIVKAKTYPEYTTEEYFLESENTDIAKIKDGIVNAIKPGITNIIAKNI
KGEEIGRFELNINHYKNDKYDELLSKIYKSLVPNNLLSVDDKEDMSAVKKIVDVGENYWK
NMNKDKGKDYLWNDLDSTTNSNHITKSFERLREMAKAYLLEGSSLKGNPQLIKDIEYGLE
WLIENRYNKGYYNNWWDWQIGIPQRLTDTLVLIRDYLTTETIEKYANIISYYVANARDQW
SLKPETHTQSVGANRLDMCQVVIYKSLLVKDGDKIQEASNDLLPELKYVTNGDGFYEDGS
IIQHTAIPYTGTYGSVLLSGIGRLNYILEGTQWAIPNDKVNMIYDVIEKSFEPLMYKGLI
MDMVNGRSISRSKWQDINNGESVMKSIVKYFIPAATEEEGNRLKGAIKYWLEANDSKNMV
ETTNDLEFRAMIKDILNDNIIKSRGELIGHYNYANMDRVVHRRPGFVYGISKYSDRTYMY
EAMNKENLKGYHTADGMTYLYNGDVEQFSKGFWPTVNPKRLPGTTVDTVTLYDEASGSKV
VNGQDWVGGSVIDGKYGASGMYLDKVNPKEQDENYKMDIKAKKSWFMFDDEIVALGSDIT
SSKNRNIETTIENRRLSEIGDEIFTVDGENSVNNIGDSKLKQGASWAHIKGNKENTDIGY
YFPSKANINILRDHRTGNWNDINESEASKVEENNFLTMWIDHGINPHSAGYSYTLLPNKS
KDEVKKYNENPDIEILENSEVVHAVKEKKLNIIAANLWEDNQGIDFIHSNKKASIMVREN
NGELTVAVSDPTMKNNNKIKVEIDKKVKNLISKDERVNIINSSDKLILEINVKDLKGSTV
ESKFNLL

Enzyme Prediction     

No EC number prediction in MGYG000001460_01255.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	451	721	1e-91	0.9884169884169884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	0.0	80	791	2	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	1.53e-103	450	720	1	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	2.65e-101	95	409	8	323	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	8.31e-17	736	795	1	63	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIY84950.1	2.81e-259	17	846	256	1097
AQM59403.1	8.95e-258	17	846	256	1097
QPW61069.1	4.90e-202	31	845	84	924
SQI63227.1	1.18e-201	3	846	291	1125
QPW55123.1	8.56e-201	31	844	80	915

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F2P_A	2.61e-177	78	846	4	751	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]
1J0M_A	5.44e-152	78	846	2	751	CrystalStructure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1],1J0N_A Crystal Structure of Bacillus sp. GL1 Xanthan Lyase that Acts on Side Chains of Xanthan [Bacillus sp. GL1]
2E24_A	2.14e-151	78	846	2	751	ChainA, Xanthan lyase [Bacillus sp. GL1]
2E22_A	4.23e-151	78	846	2	751	Crystalstructure of xanthan lyase in complex with mannose [Bacillus sp. GL1]
1X1H_A	6.53e-150	78	846	2	751	ChainA, xanthan lyase [Bacillus sp. GL1],1X1I_A Chain A, xanthan lyase [Bacillus sp. GL1],1X1J_A Chain A, xanthan lyase [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AQS0	1.57e-148	66	846	16	776	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q54873	1.05e-104	23	791	235	992	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q53591	8.38e-97	11	762	191	941	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q59801	2.34e-82	63	778	50	748	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
P0CZ01	1.43e-71	144	840	104	792	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001460_01255.