CAZyme Information: MGYG000001460_02298

Basic Information

• Species: Romboutsia dakarensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Romboutsia; Romboutsia dakarensis
• CAZyme ID: MGYG000001460_02298
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
160		18685.66	5.2806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001460	3735762	Isolate	not provided	not provided

• Gene Location: Start: 26472; End: 26954 Strand: -

Full Sequence      

MLLSIVMMVKNEEKYLDKTLNALIPLMEDINSELIILDTGSTDSSVDIAKKYTDKVHFSN
WNNDFAHMRNISISYAKGDWILILDADEELINYDKLKNFFNSDLHKKYNSASIELKNILS
EDEKGYSMAPILRLFKTIKDLDMKVLYMNNRYIKILYITV

Enzyme Prediction     

No EC number prediction in MGYG000001460_02298.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	92	1.1e-19	0.5470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	2.44e-33	3	136	2	132	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	1.33e-17	4	90	1	91	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	5.04e-15	5	87	1	87	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02525	Succinoglycan_BP_ExoA	4.02e-13	4	87	3	91	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG0463	WcaA	7.51e-12	1	88	3	94	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI72249.1	3.01e-65	1	140	1	140
AUN15183.1	3.06e-63	1	136	1	136
CEK39039.1	3.22e-63	1	136	1	136
QYE97288.1	1.18e-61	1	136	1	136
CEJ74586.1	3.15e-61	1	136	1	136

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSP_A	2.42e-11	9	87	62	138	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSN_A	2.80e-11	9	87	62	138	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
5HEA_A	2.05e-06	2	127	6	130	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42460	5.76e-13	4	91	11	94	TPR repeat-containing protein Synpcc7942_0270 OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=Synpcc7942_0270 PE=4 SV=1
O31986	1.53e-10	9	87	62	138	SPbeta prophage-derived glycosyltransferase SunS OS=Bacillus subtilis (strain 168) OX=224308 GN=sunS PE=1 SV=1
O64036	1.53e-10	9	87	62	138	Glycosyltransferase SunS OS=Bacillus phage SPbeta OX=66797 GN=sunS PE=3 SV=1
Q68XF1	3.92e-10	3	131	4	129	Uncharacterized glycosyltransferase RT0209 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0209 PE=3 SV=1
Q57022	1.07e-09	2	152	5	151	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001460_02298.